Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_011911655.1 PST_RS02170 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000013785.1:WP_011911655.1 Length = 266 Score = 136 bits (343), Expect = 4e-37 Identities = 90/265 (33%), Positives = 139/265 (52%), Gaps = 16/265 (6%) Query: 8 TTPLLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGR 67 T +L+ L FGG VAVN+V ++ + A+IGPNGAGKTT+FN +T F PT G Sbjct: 18 TPVMLSARGLRKEFGGFVAVNNVDLDVHHARVHALIGPNGAGKTTVFNLLTKFLQPTAGS 77 Query: 68 LTLRHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGF 127 + L D + R +++ + + R+FQ +F +SVL+N+ VA L R G Sbjct: 78 IRLLDHD-----ITRTDPAKVA-RMGLVRSFQISAVFPHLSVLDNVRVA----LQRPGGL 127 Query: 128 SIAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEP 187 + L + S R A+ L ++ V L + A +L YG +R LEIA + EP Sbjct: 128 ATQFWLPMRSLNRLNERAMQL----IESVGLADKRHEPAADLSYGRKRVLEIATTLALEP 183 Query: 188 VMLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRK 247 +L LDEP AG+ + +A+++ + + VL++EH++ VV + V VL G Sbjct: 184 KVLLLDEPMAGMGHEDVHVVAEIIREVATQR--AVLMVEHNLKVVADLCHQVTVLQRGEI 241 Query: 248 ISDGDPAFVKNDPAVIRAYLGEEED 272 ++ GD V D V AY+G ++D Sbjct: 242 LTSGDYRTVSQDERVRVAYMGTDDD 266 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 266 Length adjustment: 26 Effective length of query: 268 Effective length of database: 240 Effective search space: 64320 Effective search space used: 64320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory