Align 3-ketoacyl-CoA thiolase B, peroxisomal; Acetyl-CoA acyltransferase B; Beta-ketothiolase B; Peroxisomal 3-oxoacyl-CoA thiolase B; EC 2.3.1.155; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_011913616.1 PST_RS12565 thiolase family protein
Query= SwissProt::P07871 (424 letters) >NCBI__GCF_000013785.1:WP_011913616.1 Length = 394 Score = 284 bits (727), Expect = 3e-81 Identities = 168/390 (43%), Positives = 233/390 (59%), Gaps = 7/390 (1%) Query: 37 DVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGA 96 +VV+V RT + ++ RG F T PD++ + + A+L L P + D VG GA Sbjct: 3 EVVIVDSVRTGLAKSFRGKFNMTRPDDMAAHCVDALLSRNDLDPALVEDCIVGAGSNEGA 62 Query: 97 -GAAMARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTL 155 G + R LS + +NR CSSGLQA+A A I +G D+ +A GVES+TL Sbjct: 63 QGYNIGRNVAVLSRLGIACSGMTLNRYCSSGLQAIAVAANQIASGCSDVIVAGGVESITL 122 Query: 156 SERGNPGNISSRLLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQS 215 + + + + E+ MG T+E VA R+ ++R++QD ++L SQQ+ A AQ+ Sbjct: 123 TLKSRNTDHLFNPIIQERVPGIYHTMGQTAELVARRYNVTREQQDLYSLQSQQRTARAQA 182 Query: 216 KGCFRAEIVPVTTTVL--DDKGDRKTI---TVSQDEGVRPSTTMEGLAKLKPAFKDGGST 270 +G F EIVP+ D +T+ V +D+ RP TT+E LA LKPAF + GS Sbjct: 183 EGLFSDEIVPMNVQYFTEDKNTGERTLHQGVVDRDDCNRPDTTLESLAGLKPAFAEDGSV 242 Query: 271 TAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQ 330 TAGN+SQ+SDGA+ L+ KA ELGL R + V G P+ MGIGP YA+P L+ Sbjct: 243 TAGNASQLSDGASMTLVMSLDKAIELGLKPRAFFRGFTVAGCEPEEMGIGPVYAVPRLLK 302 Query: 331 KAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTL 390 GL + DID++E+NEAFASQ LYC + LGI EK N GG+I++GHP G TG+R + Sbjct: 303 AKGLQIADIDLWELNEAFASQCLYCRDTLGIDNEKYNVNGGSISIGHPFGMTGSRTAGHI 362 Query: 391 LNELKRRGRRAYGVVSMCIGTGMGAAAVFE 420 + EL+RR R YGVV+MC+G GMGAA +FE Sbjct: 363 VRELQRRNLR-YGVVTMCVGGGMGAAGLFE 391 Lambda K H 0.316 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 394 Length adjustment: 31 Effective length of query: 393 Effective length of database: 363 Effective search space: 142659 Effective search space used: 142659 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory