Align TreV, component of Trehalose porter (characterized)
to candidate WP_011913323.1 PST_RS11065 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000013785.1:WP_011913323.1 Length = 371 Score = 241 bits (614), Expect = 3e-68 Identities = 123/252 (48%), Positives = 173/252 (68%), Gaps = 4/252 (1%) Query: 3 VELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIAD 62 +++ ++ K + N +I GI I EF V +GPSG GKSTLL+++AG+E++ G+I D Sbjct: 4 LKIHNLKKGFDGNEIIKGIDLDIRDREFVVFVGPSGCGKSTLLRLIAGLEEVSSGRIELD 63 Query: 63 GADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGI 122 G DITD P KR++AMVFQ YALYP+M+VR N++F L + G K+E+ ++E AA+ L + Sbjct: 64 GRDITDVSPAKRDLAMVFQTYALYPHMTVRKNMSFALDLAGADKQEVARKIEAAARTLEL 123 Query: 123 SEILDKKVTQISGGQQQRV----ALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRI 178 +L++K Q+SGGQ+QRV A+ RAIVRNP FL DEPLSNLDA +R R EL R+ Sbjct: 124 EPLLERKPRQLSGGQRQRVAIGRAIGRAIVRNPKVFLFDEPLSNLDAALRVQMRLELSRL 183 Query: 179 QKELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPM 238 +EL+ T IYVTHDQ EA++LAD++ +L+ G+ EQV P LY +P +VA F+G M Sbjct: 184 HQELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPMELYHHPANLFVAGFLGTPKM 243 Query: 239 NFLPGELMKEKA 250 FL G + +A Sbjct: 244 GFLKGHASRVEA 255 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 371 Length adjustment: 29 Effective length of query: 295 Effective length of database: 342 Effective search space: 100890 Effective search space used: 100890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory