Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_011911840.1 PST_RS03120 enoyl-CoA hydratase/isomerase family protein
Query= reanno::Cup4G11:RR42_RS28545 (384 letters) >NCBI__GCF_000013785.1:WP_011911840.1 Length = 261 Score = 108 bits (269), Expect = 2e-28 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 14/193 (7%) Query: 25 FDEINGIGLITLNRPRQLNALSYPMIGLLDAQLAAWAARDDIAAVVLRGAGPKAFCAGGD 84 F+ + + +TLNRP+ +N+L+ M+ L+ +LA AA D++ V+L GAGP AFCAG D Sbjct: 8 FETLGPVARLTLNRPKAMNSLNLAMLAELEQRLAEIAANDELRTVILTGAGP-AFCAGAD 66 Query: 85 IRALY--DSFHAGTALHRQFFVDEYQLDYRLHCYPKPVVALMDGIVMGGGMGLAQAAHLR 142 ++ + S AG A F Q+ +L PKPV+A ++G+ M GG+ LA A + Sbjct: 67 LKEVLAGASLAAGEA---DFLDRANQVFGQLRNLPKPVIAALNGVTMAGGLELAMCADIV 123 Query: 143 VLTERSRVAMPETGIGLVPDVGASHFLSKL-PLALALYVGLTGVTLGAADTLLCKL---- 197 V + + +A G+ P G + L +L PL +A+Y+ LTG +L A++ C L Sbjct: 124 VAADSATIADAHANFGVYPGAGGAAILPRLIPLNMAMYLLLTGKSLSASEMKACGLVCEV 183 Query: 198 ---ADIAVPAASL 207 A++A A SL Sbjct: 184 HADAELAEAALSL 196 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 261 Length adjustment: 27 Effective length of query: 357 Effective length of database: 234 Effective search space: 83538 Effective search space used: 83538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory