Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_011911319.1 PST_RS00360 polyamine ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000013785.1:WP_011911319.1 Length = 383 Score = 244 bits (624), Expect = 2e-69 Identities = 140/331 (42%), Positives = 199/331 (60%), Gaps = 31/331 (9%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 +KID++ K + T A+ D++L I GE +G SG GKSTLLR LAG E + GRI + Sbjct: 23 LKIDRVTKKFDETVAVDDVSLSIHQGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLD 82 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQL 123 G+D+T + P +R + M+FQSYAL+PHMTV +N+ FG+K +G +ER+ E ++Q+ Sbjct: 83 GQDITDMPPYERPINMMFQSYALFPHMTVEQNIAFGLKQDGLPKAEIEERVKEMLGLVQM 142 Query: 124 EDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQL 183 Y RKP QLSGGQRQRVA+ R++ K P + L DEP+ LD KLR QM++EL + +++ Sbjct: 143 TQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVQIIERV 202 Query: 184 GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMNVFS 243 G T + VTHDQ EAMTMA++I ++++G I QVGSPMD+Y P SR V EFIG+ +N+F Sbjct: 203 GVTCVMVTHDQEEAMTMAERIAIMHQGWIAQVGSPMDIYETPASRLVCEFIGN--VNLFE 260 Query: 244 SDV--GLQDISLDASAA-----FVG---------------CRPEHI-------EIVPDGD 274 ++ + D ++ AS +VG RPE + E+ G Sbjct: 261 GELVEDMGDHAIIASPGLDNPIYVGHGISTRAQDKHITYALRPEKLLIGTELPELERPGY 320 Query: 275 GHIAATVHVKERLGGESLLYLGLKGGGQIVA 305 VH LGG S+ Y+ L GG + A Sbjct: 321 NWAKGVVHDIAYLGGHSVYYIKLPSGGVLQA 351 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 383 Length adjustment: 29 Effective length of query: 309 Effective length of database: 354 Effective search space: 109386 Effective search space used: 109386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory