Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_011913323.1 PST_RS11065 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000013785.1:WP_011913323.1 Length = 371 Score = 297 bits (760), Expect = 4e-85 Identities = 166/373 (44%), Positives = 244/373 (65%), Gaps = 16/373 (4%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MA L++ N+ K + + +K I+L I++ EF++ VGPSGCGKSTL+ IAGLE ++ G Sbjct: 1 MADLKIHNLKKGFDGN--EIIKGIDLDIRDREFVVFVGPSGCGKSTLLRLIAGLEEVSSG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I + +D++ +SP RD+AMVFQ+YALYP M+VR+N+ F L + + ++ ++ A Sbjct: 59 RIELDGRDITDVSPAKRDLAMVFQTYALYPHMTVRKNMSFALDLAGADKQEVARKIEAAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRV----AMGRALARRPKIYLFDEPLSNLDAKLRVEMRT 176 + L++E LL RKP QLSGGQ+QRV A+GRA+ R PK++LFDEPLSNLDA LRV+MR Sbjct: 119 RTLELEPLLERKPRQLSGGQRQRVAIGRAIGRAIVRNPKVFLFDEPLSNLDAALRVQMRL 178 Query: 177 EMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFI 236 E+ +HQ L+ T +YVTHDQ+EAMTL DKV V+ G I+Q G+P E+Y++PAN FVA F+ Sbjct: 179 ELSRLHQELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPMELYHHPANLFVAGFL 238 Query: 237 GSPPMNFVPLRLQRKDGRLVAL-LDSGQARCELALNTTEAGLEDRD-VILGLRPEQIMLA 294 G+P M F+ R + + LD+G C L L + A L+ D V LG+RPE + Sbjct: 239 GTPKMGFLKGHASRVEASGCEVELDAG---CRLFLPVSGATLKAGDPVTLGIRPEHLN-R 294 Query: 295 AGEGDSASSIRAEVQVTEPTGPDTLV-FVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSK 353 EG+ +++A+ V+E G DT V N ++ R+ D P+ GE+L+L + + Sbjct: 295 GSEGNCQLTVKAD--VSERLGSDTYCHVVTRNGEQLTMRIRGDFTPRYGESLSLTLEAAH 352 Query: 354 VLLFDANTGERLG 366 LFD ++G+ +G Sbjct: 353 CHLFD-SSGQAVG 364 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 371 Length adjustment: 30 Effective length of query: 356 Effective length of database: 341 Effective search space: 121396 Effective search space used: 121396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory