Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 317 bits (811), Expect = 4e-91 Identities = 173/362 (47%), Positives = 236/362 (65%), Gaps = 10/362 (2%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M+SV +RD+ +FG VL + + I+ GEF+VL+G SGCGKSTLL +AGL +++ G I Sbjct: 1 MSSVQIRDVRKSFGGFEVLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSGTI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I +R V +PK+R I MVFQ+YALYP MTV N+ F LK+ P +I+K V RA+EI Sbjct: 61 SIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAAEI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L + PLL R P +LSGGQRQRVA+GRA+VRD VFLFDEPLSNLDAKLR +R EIK LH Sbjct: 121 LALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKELH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 Q LK T +YVTHDQIEA+T+AD+I VM G+++Q+ P+ +Y+ P+N FVAGFIGSP+MN Sbjct: 181 QRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPAMN 240 Query: 241 FFRGEVEPKDGRSFVRA-GGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPT 299 F G ++ +G +V G + PA + G+ VV G+RPEH+++ A DG Sbjct: 241 FLNGHLK-SNGTVYVETDNGAKLPLLTAPAASN---GRPVVYGVRPEHLEL--ADDG--- 291 Query: 300 HQAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAESEN 359 +A V + EP G++ + Q + + PG+ + L A +FD ++ Sbjct: 292 IEAEVVVVEPTGSETQIVARIGTQDIIAVFRDRHEVVPGAKIHLRPRASAAHLFDKDTGR 351 Query: 360 RL 361 RL Sbjct: 352 RL 353 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 353 Length adjustment: 29 Effective length of query: 332 Effective length of database: 324 Effective search space: 107568 Effective search space used: 107568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory