Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_012046249.1 BBTA_RS29970 class II fructose-bisphosphate aldolase
Query= BRENDA::Q55664 (359 letters) >NCBI__GCF_000015165.1:WP_012046249.1 Length = 360 Score = 464 bits (1193), Expect = e-135 Identities = 227/349 (65%), Positives = 278/349 (79%) Query: 1 MALVPMRLLLDHAAENGYGIPAFNVNNMEQIISIMQAADETDSPVILQASRGARSYAGEN 60 MA + +R LLDHAAE GYG+PAFN+NNMEQ ++IM+AA D+PVI+QASRGARSYAG+ Sbjct: 1 MARITLRQLLDHAAERGYGVPAFNINNMEQGLAIMEAAAAVDAPVIIQASRGARSYAGDI 60 Query: 61 FLRHLVLGAVETYPHIPIAMHQDHGNSPATCYSAIRNGFTSVMMDGSLEADAKTPASFEY 120 L ++ E YP IP+ +HQDHGN ATC +AI+ GFTSVMMDGSL+ADAKT A +EY Sbjct: 61 MLSKMIDALEEMYPQIPLCLHQDHGNDEATCATAIKYGFTSVMMDGSLKADAKTAADYEY 120 Query: 121 NVNVTAEVVKVAHSVGASVEGELGCLGSLETGQGEAEDGHGFEGKLDHSQLLTDPEEAVE 180 NV++T VV++AH VGASVEGELG LGSLE G GE EDGHG EGK+ QLLTDP++AV+ Sbjct: 121 NVDITRRVVEMAHWVGASVEGELGVLGSLEHGGGEQEDGHGLEGKVSREQLLTDPDQAVD 180 Query: 181 FVNKTQVDALAVAIGTSHGAYKFTRKPTGEVLAISRIEEIHRLLPNTHLVMHGSSSVPQE 240 FV T+VDALA+A+GTSHGAYKF+RKP GE+LA++ IEEIHR LPNTHLVMHGSSSVPQ Sbjct: 181 FVRATKVDALAIAMGTSHGAYKFSRKPDGEILAMNVIEEIHRRLPNTHLVMHGSSSVPQA 240 Query: 241 WIDMINEFGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAFREAAAKDPKNFD 300 DM N+FGG +P+T+GVPVEEI +GI+ GVRKVNIDTD RLA+TA FR+ A FD Sbjct: 241 LQDMFNQFGGEMPQTWGVPVEEIVRGIRHGVRKVNIDTDCRLAMTAIFRKVGASSKVEFD 300 Query: 301 PRHFLKPSIKYMKQVCADRYQQFWTAGNASKIKQLTLDDYAAKYAKGEL 349 PR FLKP++ M+++C +R++QF AGNASKIK L L + A +Y G L Sbjct: 301 PRKFLKPAMDSMRELCRERFEQFGAAGNASKIKVLPLSEMAKRYRSGAL 349 Lambda K H 0.315 0.131 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 360 Length adjustment: 29 Effective length of query: 330 Effective length of database: 331 Effective search space: 109230 Effective search space used: 109230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012046249.1 BBTA_RS29970 (class II fructose-bisphosphate aldolase)
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01521.hmm # target sequence database: /tmp/gapView.2317168.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01521 [M=347] Accession: TIGR01521 Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-191 620.5 0.2 4.4e-191 620.4 0.2 1.0 1 NCBI__GCF_000015165.1:WP_012046249.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000015165.1:WP_012046249.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 620.4 0.2 4.4e-191 4.4e-191 1 347 [] 3 349 .. 3 349 .. 1.00 Alignments for each domain: == domain 1 score: 620.4 bits; conditional E-value: 4.4e-191 TIGR01521 1 lislrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrklvlaaveeypd 73 +i+lrqlldhaaergygvpafn+nn+eq laimeaa + d+pvi+qasrgarsyag+ +l k++ a++e+yp+ NCBI__GCF_000015165.1:WP_012046249.1 3 RITLRQLLDHAAERGYGVPAFNINNMEQGLAIMEAAAAVDAPVIIQASRGARSYAGDIMLSKMIDALEEMYPQ 75 69*********************************************************************** PP TIGR01521 74 ipvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaevvklahavgasvegelgclgs 146 ip++lhqdhgn+ atc +ai+ gftsvmmdgslk+dakt ady+ynv++t +vv++ah vgasvegelg lgs NCBI__GCF_000015165.1:WP_012046249.1 76 IPLCLHQDHGNDEATCATAIKYGFTSVMMDGSLKADAKTAADYEYNVDITRRVVEMAHWVGASVEGELGVLGS 148 ************************************************************************* PP TIGR01521 147 letgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdalavaigtshgaykftrkptgevlaidrieeih 219 le g ge+edghg+eg++ r qlltdp++a++fv+ tkvdala+a+gtshgaykf+rkp ge+la+++ieeih NCBI__GCF_000015165.1:WP_012046249.1 149 LEHGGGEQEDGHGLEGKVSREQLLTDPDQAVDFVRATKVDALAIAMGTSHGAYKFSRKPDGEILAMNVIEEIH 221 ************************************************************************* PP TIGR01521 220 erlpdthlvmhgsssvpqewldvineyggeiketygvpveeivkgikfgvrkvnidtdlrlaataalrrvaak 292 +rlp+thlvmhgsssvpq +d++n++gge+++t+gvpveeiv+gi++gvrkvnidtd rla+ta +r+v a NCBI__GCF_000015165.1:WP_012046249.1 222 RRLPNTHLVMHGSSSVPQALQDMFNQFGGEMPQTWGVPVEEIVRGIRHGVRKVNIDTDCRLAMTAIFRKVGAS 294 ************************************************************************* PP TIGR01521 293 dpsefdprkflkkaveamkdvckaryeafgtagnaskikvvsleemarryakgel 347 ++ efdprkflk+a++ m+++c +r+e+fg+agnaskikv++l ema+ry +g l NCBI__GCF_000015165.1:WP_012046249.1 295 SKVEFDPRKFLKPAMDSMRELCRERFEQFGAAGNASKIKVLPLSEMAKRYRSGAL 349 ***************************************************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (347 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory