Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 344 bits (882), Expect = 2e-99 Identities = 187/365 (51%), Positives = 238/365 (65%), Gaps = 16/365 (4%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 M+ V + + K++ G + + I+D EF V VGPSGCGK+T LRM+AGLE+IT G Sbjct: 1 MSSVQIRDVRKSFGGFE--VLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 + IG+R VN+V PK+RDIAMVFQNYALYPHMTV NM F LKLR +I + V AA Sbjct: 59 TISIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAA 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 +IL + LLDR P+ LSGGQRQRVA+GRAIVR+PQVFL DEPLSNLDAKLRV MR EI++ Sbjct: 119 EILALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKE 178 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 LHQRL+TT +YVTHDQ EAMTM D+IVVM DG+++Q +P +Y +P N FVAGFIGSPA Sbjct: 179 LHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPA 238 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFM 300 MNF+ G + +G + L L + + + G+PVV GVRPE L Sbjct: 239 MNFLNGHLKSNGTVYVETDNGAKLPL------LTAPAASNGRPVVYGVRPEHLE------ 286 Query: 301 TTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLNKIHI 360 D ++ +V VVE GSE + IG I+A RH G+ + L + H+ Sbjct: 287 --LADDGIEAEVVVVEPTGSETQIVARIGTQDIIAVFRDRHEVVPGAKIHLRPRASAAHL 344 Query: 361 FDAET 365 FD +T Sbjct: 345 FDKDT 349 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 353 Length adjustment: 30 Effective length of query: 354 Effective length of database: 323 Effective search space: 114342 Effective search space used: 114342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory