Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 323 bits (828), Expect = 4e-93 Identities = 176/354 (49%), Positives = 229/354 (64%), Gaps = 27/354 (7%) Query: 26 LDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDASPKDRDIAMVFQN 85 + I D EF+V VGPSGCGKST LRM+AGLE+IT G + I ++++N+ PK+RDIAMVFQN Sbjct: 24 IPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSGTISIGERVVNNVQPKERDIAMVFQN 83 Query: 86 YALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTEFLERKPADLSGGQRQRVA 145 YALYPHM+V +NM F LKLR + +DI K V AAEIL LT L+R P LSGGQRQRVA Sbjct: 84 YALYPHMTVADNMGFSLKLRGARPEDIKKGVARAAEILALTPLLDRYPRQLSGGQRQRVA 143 Query: 146 MGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYVTHDQTEAMTLADR 205 MGRAIVRD +VFL DEPLSNLDAKLRVAMR EI ++H+R+ TT+YVTHDQ EAMT+AD+ Sbjct: 144 MGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKELHQRLKTTTVYVTHDQIEAMTMADK 203 Query: 206 IVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVTVEKERLV- 264 IV+M G +EQ+G+P +LY++P N+FVAGFIGSPAMNF ++ V Sbjct: 204 IVVMHD----------GIVEQMGSPLDLYDKPDNQFVAGFIGSPAMNFLNGHLKSNGTVY 253 Query: 265 --NQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPEDISSDQIVHETFPNASVTADILVS 322 +G L L + G+ V G+RPE H + + A+++V Sbjct: 254 VETDNGAKLPL------LTAPAASNGRPVVYGVRPE--------HLELADDGIEAEVVVV 299 Query: 323 ELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLTFNIAKGHFFDLETEKRI 376 E GSE+ + + G+ + A R PG K+ L + H FD +T +R+ Sbjct: 300 EPTGSETQIVARIGTQDIIAVFRDRHEVVPGAKIHLRPRASAAHLFDKDTGRRL 353 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 353 Length adjustment: 30 Effective length of query: 347 Effective length of database: 323 Effective search space: 112081 Effective search space used: 112081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory