Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 322 bits (825), Expect = 1e-92 Identities = 186/380 (48%), Positives = 239/380 (62%), Gaps = 32/380 (8%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 M++V +D S+ G + + + I DGEF+VLVGPSGCGKST LRMLAGLEN+T G Sbjct: 1 MSSVQIRDVRKSFGGFE--VLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSG 58 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 I IG++ V +V P++RDIAMVFQNYALYPHMTV +NMGF+LK+ G ++I K V AA Sbjct: 59 TISIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAA 118 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 L LT L+R P+ LSGGQRQRVAMGRAIVR+PQVFL DEPLSNLDAKLRV RT+I Sbjct: 119 EILALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKE 178 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 L ++L TTVYVTHDQ EA+TM D+I V+ DG ++Q+G+P +LYD+P N FVAGFIGSPA Sbjct: 179 LHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPA 238 Query: 241 MNLGTFSVKDGDA----TSGHARIKLSPETLAAMTPEDNGR-ITIGFRPEALEIIPEGES 295 MN +K T A++ L A+ NGR + G RPE LE+ +G Sbjct: 239 MNFLNGHLKSNGTVYVETDNGAKLPLLTAPAAS-----NGRPVVYGVRPEHLELADDGIE 293 Query: 296 TDLSIPIKLDFVEELGSDSFLYGKLVGEGDLGSSSEDVPESGQIVVRAAPNAAPAPGSVF 355 ++ + VE GS++ + + +G D+ + D E PG+ Sbjct: 294 AEVVV------VEPTGSETQIVAR-IGTQDIIAVFRDRHE-------------VVPGAKI 333 Query: 356 HARIVEGGQHNFSASTGKRL 375 H R H F TG+RL Sbjct: 334 HLRPRASAAHLFDKDTGRRL 353 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 353 Length adjustment: 29 Effective length of query: 347 Effective length of database: 324 Effective search space: 112428 Effective search space used: 112428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory