Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 338 bits (867), Expect = 1e-97 Identities = 180/356 (50%), Positives = 243/356 (68%), Gaps = 9/356 (2%) Query: 1 MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGTI 60 M++++I++++K F GF ++ G+ + + D EFVV VGPSGCGKSTLLR++AGLE ++ GTI Sbjct: 1 MSSVQIRDVRKSFGGFEVLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSGTI 60 Query: 61 ELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAARI 120 + R + V P +RD+AMVFQ YALYPHM+V NM F+L L G +++K V+ AA I Sbjct: 61 SIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAAEI 120 Query: 121 LELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLRLH 180 L L P+L+R P+QLSGGQRQRVA+GRAIVR+P++FLFDEPLSNLDA LRV MR E+ LH Sbjct: 121 LALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKELH 180 Query: 181 KELQATMIYVTHDQVEAMTMADKVVVLNGGKIEQVGSPLDLYHQPANLFVAGFLGTPKMG 240 + L+ T +YVTHDQ+EAMTMADK+VV++ G +EQ+GSPLDLY +P N FVAGF+G+P M Sbjct: 181 QRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPAMN 240 Query: 241 FLKGKITRVDSQGCEVQLDAGTRVSLPLGGRHLSVGSAVTLGIRPEHLELAKPGDCALQV 300 FL G + + V+ D G ++ L L S G V G+RPEHLELA G ++ Sbjct: 241 FLNGHLK--SNGTVYVETDNGAKLPL-LTAPAASNGRPVVYGVRPEHLELADDG---IEA 294 Query: 301 TADVSERLGSDTFCHVRTASGEALTM-RVRGDLASRYGETLSLHLDAQHCHLFDAD 355 V E GS+T R + + + + R R ++ G + L A HLFD D Sbjct: 295 EVVVVEPTGSETQIVARIGTQDIIAVFRDRHEVVP--GAKIHLRPRASAAHLFDKD 348 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 353 Length adjustment: 29 Effective length of query: 338 Effective length of database: 324 Effective search space: 109512 Effective search space used: 109512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory