Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 334 bits (856), Expect = 2e-96 Identities = 184/354 (51%), Positives = 240/354 (67%), Gaps = 8/354 (2%) Query: 1 MTGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM 60 M+ + ++D+RKS+G +V+HG+ + I++GEFVV VGPSGCGKSTLLRM+AGLE IT G + Sbjct: 1 MSSVQIRDVRKSFGGFEVLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSGTI 60 Query: 61 FIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADM 120 I VN+V P +R IAMVFQ+YALYPHMTV DNM F +++ E+I + V AA++ Sbjct: 61 SIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAAEI 120 Query: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS 180 L LTP LDR P+ LSGGQRQRVA+GRAI R+P+VFLFDEPLSNLDA LRVA R EI +L Sbjct: 121 LALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKELH 180 Query: 181 ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM 240 +R+ TT +YVTHDQ+EAMT+AD+IVV+ G +EQ+G+PL+LY++P N FVA FIGSPAM Sbjct: 181 QRLK-TTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPAM 239 Query: 241 NVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFLFEG 300 N + + + G + G K L P A+ NG+ +GVRPE L + ADD + E Sbjct: 240 NFLNGHLKSNGTVYVETDNGAKLPLLTAP--AASNGRPVVYGVRPEHLEL--ADDGI-EA 294 Query: 301 TVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFD 354 V +VE G T I + + IIA V G K+ + HLFD Sbjct: 295 EVVVVEPTGSET--QIVARIGTQDIIAVFRDRHEVVPGAKIHLRPRASAAHLFD 346 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 353 Length adjustment: 29 Effective length of query: 333 Effective length of database: 324 Effective search space: 107892 Effective search space used: 107892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory