Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_041750694.1 BBTA_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000015165.1:WP_041750694.1 Length = 353 Score = 307 bits (787), Expect = 3e-88 Identities = 173/354 (48%), Positives = 226/354 (63%), Gaps = 9/354 (2%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 M+ +++ V K++G +VL + + I+ GE +V VGPSGCGKSTLLRM+AGLE IT GT+ Sbjct: 1 MSSVQIRDVRKSFGGFEVLHGVTIPIEDGEFVVLVGPSGCGKSTLLRMLAGLENITSGTI 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 I VVN+V P +R IAMVFQ+YALYPHMTV +NM F+LK+ +I V AAE Sbjct: 61 SIGERVVNNVQPKERDIAMVFQNYALYPHMTVADNMGFSLKLRGARPEDIKKGVARAAEI 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 L L LDR P+ LSGGQRQRVA+GR+IVRDP+V+LFDEPLSNLDA LRVA R EI +L Sbjct: 121 LALTPLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRTEIKELH 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 + + ++T VYVTHDQ+EAMT+A +IVV+ G + Q+GSPL+LY+KP+N+FVA FIGSP M Sbjct: 181 QRL-KTTTVYVTHDQIEAMTMADKIVVMHDGIVEQMGSPLDLYDKPDNQFVAGFIGSPAM 239 Query: 241 NLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYVFE 300 N L G + G T TD G + + + G V GVRPE + A G E Sbjct: 240 NFLNGHLKSNG--TVYVETDNGAKLPLLTAPAASNGRPVVYGVRPEHLELADDG----IE 293 Query: 301 GKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHVF 354 +V + E G T + A G I + H+ + G L + H+F Sbjct: 294 AEVVVVEPTGSETQIV--ARIGTQDIIAVFRDRHEVVPGAKIHLRPRASAAHLF 345 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 353 Length adjustment: 29 Effective length of query: 344 Effective length of database: 324 Effective search space: 111456 Effective search space used: 111456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory