Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_012047541.1 BBTA_RS36615 ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_000015165.1:WP_012047541.1 Length = 330 Score = 204 bits (518), Expect = 3e-57 Identities = 111/292 (38%), Positives = 171/292 (58%), Gaps = 1/292 (0%) Query: 13 IFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSILG 72 +++ + ++V +++ FL+V+N + + ++I++ GMT +II IDLSV S L Sbjct: 35 LYIAFVILLVVFSLSSPWFLSVDNFLNIGRQTTLVSIIAVGMTFIIIARQIDLSVASTLA 94 Query: 73 AASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSVGRGL 132 + + L M + S + V GL G GL NG+L T+ + F+ TLG LS+ RGL Sbjct: 95 LSGMAAALAMSQINNSWIVGAVAGLGTGALVGLLNGILTTQLSIPSFLVTLGSLSMARGL 154 Query: 133 AYVMSGGWPISPFPES-FTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIYAIG 191 A +++ P+ E+ F + G+G + +PVP+ + ++ + L Y V GRRIYA+G Sbjct: 155 AMMVTNTKPVIITNETYFAIFGEGTLLGIPVPIAWTLAAMIVGILLLHYNVFGRRIYAVG 214 Query: 192 GNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDVIAATVI 251 GN A+ GI T I + + G LA A +L+A A+P+ QG ELDVIAA ++ Sbjct: 215 GNPTAALYSGINTKLITTAAFVLTGTLAGLAALVLSARSHAARPDVVQGMELDVIAAVIL 274 Query: 252 GGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIA 303 GG SL GG G ILG G++I+G L NG++LLGVSS Q V+ G +I+ A+A Sbjct: 275 GGCSLFGGRGYILGTLFGSLIIGTLNNGLVLLGVSSPMQLVIKGAIIVAAVA 326 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 330 Length adjustment: 28 Effective length of query: 285 Effective length of database: 302 Effective search space: 86070 Effective search space used: 86070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory