Align Inner-membrane translocator (characterized, see rationale)
to candidate WP_011801983.1 PNAP_RS13005 ABC transporter permease
Query= uniprot:A0KWY6 (405 letters) >NCBI__GCF_000015505.1:WP_011801983.1 Length = 317 Score = 134 bits (338), Expect = 3e-36 Identities = 89/264 (33%), Positives = 142/264 (53%), Gaps = 4/264 (1%) Query: 100 ILNRSAPVALLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIV 159 I+ + V +++IG +L+I T GIDLS G VMA+ G V L + IA G+ V Sbjct: 41 IMQQVMVVGVIAIGQTLIILTAGIDLSCGMVMALGGIVMTKLSADFGLPTPVAIACGMAV 100 Query: 160 GLLAGCINGGLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLG 219 +L G ING LV+ + + P + TL + + QL +Q Q +T G +G +G Sbjct: 101 TMLFGLINGLLVTRIKLPPFIVTLGTLNIAFAITQLYSQSQTVTDIPAGMTFLGNTFTIG 160 Query: 220 ---LPMPVWIVIGMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAG 276 + V +++ + + L LR+TA G I AVG + +A+R GI + L Y +AG Sbjct: 161 NTSMGYGVVLMLALYVATWLWLRETAPGRHIYAVGNSPEATRLTGIATDRVLLGVYVLAG 220 Query: 277 LCAALAGMISTADIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQT 336 L +A ++S A D NAG LDA+ AVV+GG +L GGR L+ ++VGALI+ Sbjct: 221 LFYGIASLLSVARTGAGDP-NAGQTENLDAITAVVLGGTSLFGGRGMLLGTLVGALIVGV 279 Query: 337 LATTIIVSGLPAKFNLLIKAIVIL 360 + + G+ + + +L+ I+++ Sbjct: 280 FRNGLTLMGVSSVYQVLVTGILVI 303 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 317 Length adjustment: 29 Effective length of query: 376 Effective length of database: 288 Effective search space: 108288 Effective search space used: 108288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory