Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate WP_011801983.1 PNAP_RS13005 ABC transporter permease
Query= SwissProt::P39328 (341 letters) >NCBI__GCF_000015505.1:WP_011801983.1 Length = 317 Score = 141 bits (355), Expect = 3e-38 Identities = 103/283 (36%), Positives = 147/283 (51%), Gaps = 11/283 (3%) Query: 59 ILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVA-GFSLPIVLLSALGT 117 I+ + V ++AIG TL+I T GIDLS G VMA+ G ++ G P+ + + Sbjct: 41 IMQQVMVVGVIAIGQTLIILTAGIDLSCGMVMALGGIVMTKLSADFGLPTPVAIACGMAV 100 Query: 118 GILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLF 177 +L GL NG+LV +K+ PF+ TL + + QL + Q VT +++ G+ + Sbjct: 101 TMLFGLINGLLVTRIKLPPFIVTLGTLNIAFAITQLYSQSQTVTDIPAGMTFLGNTFTIG 160 Query: 178 LPTPVIIAVLTLILF---WLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSG 234 + VL L L+ WL R+TA G I AVG + A + G+ T +++ YVL+G Sbjct: 161 NTSMGYGVVLMLALYVATWLWLRETAPGRHIYAVGNSPEATRLTGIATDRVLLGVYVLAG 220 Query: 235 LCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQG 294 L IA ++ A GA NAG LDAI AVV+GG SL GGR LL ++VGALI+ Sbjct: 221 LFYGIASLLSVART-GAGDPNAGQTENLDAITAVVLGGTSLFGGRGMLLGTLVGALIVGV 279 Query: 295 MNTGILLSGFPPEMNQVVKAV-VVLCVLIVQSQRFISLIKGVR 336 G+ L G +V + V+L V Q R KGVR Sbjct: 280 FRNGLTLMGVSSVYQVLVTGILVILAVTTDQMSR-----KGVR 317 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 317 Length adjustment: 28 Effective length of query: 313 Effective length of database: 289 Effective search space: 90457 Effective search space used: 90457 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory