Align Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_011799663.1 PNAP_RS01130 carbohydrate ABC transporter permease
Query= uniprot:A0A165KQ00 (289 letters) >NCBI__GCF_000015505.1:WP_011799663.1 Length = 298 Score = 120 bits (300), Expect = 5e-32 Identities = 87/284 (30%), Positives = 145/284 (51%), Gaps = 17/284 (5%) Query: 17 YAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSA--WGTAWQSACTGVD 74 YA+ AL AFFLLPL M V++FK E LL GSL + Q+ D Sbjct: 21 YALHALLVAFFLLPLVFMFVSAFKGDE----LQLLGDMGSLMAFVPHGDLSLQNFHDVFD 76 Query: 75 CNGLRPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQVVL 134 + + F NSV V + + ++ Y L+ ++FRG D L M++ + +PF+ V Sbjct: 77 RSPFKLAFFNSVLTVSLTVALGLIVNSMLAYALARFQFRGRDTLLAMVVALIIIPFEAVA 136 Query: 135 LPMSQV---LGWLGLSSSITGLV------LVHCLAGLAGTTLFFRNYYAAIPKELVNAAR 185 +P+ + L W S +TG + ++ +A LF++ ++ A+PK+L AA Sbjct: 137 VPLLLLVNELPWFNGHSVVTGWLDSYHVQVIPFIANAFSVYLFYQ-FFIALPKDLEEAAL 195 Query: 186 MDGASFFQIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLAN 245 MDGAS ++I+W IV+PLS P++ + QF W D L+ V+ D+ T+ L Sbjct: 196 MDGASRWRIYWSIVMPLSKPVIATVTVLQFLARWGDLLWPVMVVRGDTF-ATLPLAMQTF 254 Query: 246 TSSSVKAYNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 + + MA A +A LPT++++++ ++FV+ + +KG Sbjct: 255 FGQFPRQWGDVMAFAAMATLPTLLLFIVFQRWFVKSAISSGIKG 298 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 298 Length adjustment: 26 Effective length of query: 263 Effective length of database: 272 Effective search space: 71536 Effective search space used: 71536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory