Align Ribose import permease protein RbsC (characterized)
to candidate WP_011801983.1 PNAP_RS13005 ABC transporter permease
Query= SwissProt::P0AGI1 (321 letters) >NCBI__GCF_000015505.1:WP_011801983.1 Length = 317 Score = 203 bits (517), Expect = 4e-57 Identities = 116/295 (39%), Positives = 173/295 (58%), Gaps = 2/295 (0%) Query: 24 IALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALT 83 IALL+ +T + F T+ N I+QQ V ++A+G TL+ILT+GIDLS G ++AL Sbjct: 16 IALLLACVFFATQNERFLTLQNFSLIMQQVMVVGVIAIGQTLIILTAGIDLSCGMVMALG 75 Query: 84 GAVAASI-VGIEVNALVAVAAALALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTM 142 G V + + VA+A +A+ G + G++V + ++ FI TL + + +T Sbjct: 76 GIVMTKLSADFGLPTPVAIACGMAVTMLFGLINGLLVTRIKLPPFIVTLGTLNIAFAITQ 135 Query: 143 VYTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRLGRYIYAL 202 +Y+ V L F IG + V +M +++A W L T GR+IYA+ Sbjct: 136 LYSQSQTVTDIPAGMTFLGNTFTIGNT-SMGYGVVLMLALYVATWLWLRETAPGRHIYAV 194 Query: 203 GGNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVARLSSAQPTAGTGYELDAIAAVV 262 G + ATRL+GI +++ + VY L GL +A ++ VAR + P AG LDAI AVV Sbjct: 195 GNSPEATRLTGIATDRVLLGVYVLAGLFYGIASLLSVARTGAGDPNAGQTENLDAITAVV 254 Query: 263 LGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVD 317 LGGTSL GG+G ++GTL+GALI+G NGL L+GVSS YQ++V ++++LAV D Sbjct: 255 LGGTSLFGGRGMLLGTLVGALIVGVFRNGLTLMGVSSVYQVLVTGILVILAVTTD 309 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 317 Length adjustment: 28 Effective length of query: 293 Effective length of database: 289 Effective search space: 84677 Effective search space used: 84677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory