Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_011801983.1 PNAP_RS13005 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000015505.1:WP_011801983.1 Length = 317 Score = 227 bits (579), Expect = 3e-64 Identities = 118/308 (38%), Positives = 187/308 (60%), Gaps = 6/308 (1%) Query: 21 SLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLS 80 S+ + G + +L CV A +E F+T +N+ I++Q + G++A+G T +ILT GIDLS Sbjct: 8 SIAKLGPFIALLLACVFFATQNERFLTLQNFSLIMQQVMVVGVIAIGQTLIILTAGIDLS 67 Query: 81 VGSILAFAGLCSAMVATQ-GYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGML 139 G ++A G+ ++ G A++ GM + G++NG +V + +PPF+ TLG L Sbjct: 68 CGMVMALGGIVMTKLSADFGLPTPVAIACGMAVTMLFGLINGLLVTRIKLPPFIVTLGTL 127 Query: 140 SIARGMTFILNDGSPITDLPDAYLALG----IGKIGPIGVPIIIFAVVALIFWMVLRYTT 195 +IA +T + + +TD+P LG IG +G +++ + + W+ LR T Sbjct: 128 NIAFAITQLYSQSQTVTDIPAGMTFLGNTFTIGNTS-MGYGVVLMLALYVATWLWLRETA 186 Query: 196 YGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYE 255 GR++YAVG + ++ R +GI +V+ VYV++GL G+A ++ ART + P AG + Sbjct: 187 PGRHIYAVGNSPEATRLTGIATDRVLLGVYVLAGLFYGIASLLSVARTGAGDPNAGQTEN 246 Query: 256 LDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAV 315 LDAI AVV+GGTSL GG G ++GTL GAL++GV NGL L+GVSS YQ + G++++ AV Sbjct: 247 LDAITAVVLGGTSLFGGRGMLLGTLVGALIVGVFRNGLTLMGVSSVYQVLVTGILVILAV 306 Query: 316 LIDVWRKK 323 D +K Sbjct: 307 TTDQMSRK 314 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 317 Length adjustment: 28 Effective length of query: 297 Effective length of database: 289 Effective search space: 85833 Effective search space used: 85833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory