Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_011800647.1 PNAP_RS06215 SDR family oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >NCBI__GCF_000015505.1:WP_011800647.1 Length = 260 Score = 135 bits (339), Expect = 1e-36 Identities = 89/251 (35%), Positives = 127/251 (50%), Gaps = 11/251 (4%) Query: 2 SSAIYPSLKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIP 61 SS I L G+ ++TGG GIG FAR+GA+V+ DI D AL EL G Sbjct: 5 SSTISFGLAGRVCIVTGGAQGIGEACIRRFAREGAQVVVADIDDARGAALAGELGG---- 60 Query: 62 PVYKRCDLMNLEAIKAVFAEI----GDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLR 117 +Y CD+ + + A+ A+ G +DVLVNNAG +VT A +D + +NL+ Sbjct: 61 -LYVHCDVGDKAQVDALVAQAMAAHGRIDVLVNNAGIFKAADFLEVTEADFDAVLRINLK 119 Query: 118 HMLFCTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPD 177 QAVA M K G G+++N S++ L + + Y +K GI +TR +A L Sbjct: 120 GSFLVGQAVAREMAKAGQGSIVNMSSVNAVLAIPTIASYNVSKGGINQLTRVMALALADK 179 Query: 178 DIRVTCVVPGNVKTKRQEK--WYTPEGEAQIVAAQCLKGRIVPENVAALVLFLASDDASL 235 IRV V PG + T+ K + E +A+I++ +K P +A V +LASD AS Sbjct: 180 GIRVNAVAPGTIATELAAKAVLTSEEAKARIMSRTPMKRLGEPSEIADTVAYLASDAASY 239 Query: 236 CTGHEYWIDAG 246 TG D G Sbjct: 240 ITGEIVVADGG 250 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 260 Length adjustment: 24 Effective length of query: 224 Effective length of database: 236 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory