Align Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)
to candidate WP_041670877.1 RSPH17029_RS18130 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9CES4 (247 letters) >NCBI__GCF_000015985.1:WP_041670877.1 Length = 242 Score = 235 bits (600), Expect = 5e-67 Identities = 115/239 (48%), Positives = 165/239 (69%) Query: 7 IEVTDLHKSFGKNEVLKGITTKFEKGDVVCIIGPSGSGKSTFLRALNGLETATSGDIIID 66 I ++ + K +G +VL ++ KG+ V + GPSGSGKST +R +N LE SG I + Sbjct: 2 IRMSHVSKWYGHFQVLHDVSLDVRKGERVVVCGPSGSGKSTLIRCINRLEVHQSGQIFVK 61 Query: 67 GFNLTDKNTNLNLVRQNVGMVFQHFNLFPNMTVMQNITYAPVELKKMSKDDADKKAIQLL 126 G +TD N++ +R+++GMVFQ+FNLFP++TV++N+T P+ ++M K A+ A+ L Sbjct: 62 GLEMTDNVKNIDTIRRHIGMVFQNFNLFPHLTVLENLTLGPMLTRQMKKSAAEDLAMHFL 121 Query: 127 ETVGLLDKKDAMPEMLSGGQKQRVAIARALAMNPDVMLFDEPTSALDPEMVGDVLAVMQK 186 V + ++ P LSGGQ+QRVAIAR+L M P++MLFDEPTSALDPEM+ +VL M + Sbjct: 122 RKVRIPEQSGKYPLQLSGGQQQRVAIARSLCMEPEIMLFDEPTSALDPEMIKEVLDTMIE 181 Query: 187 LAEEGMTMLIVTHEMGFARKVANRVIFTDGGVILEDGTPEELFDSPKHPRLQDFLSKVL 245 LAE GMTM++VTHEMGFAR VA+ V+F G +E G PEE F +P+ R + FL ++L Sbjct: 182 LAESGMTMIVVTHEMGFARTVADNVVFMADGRKVESGPPEEFFGNPREERTRAFLDQIL 240 Lambda K H 0.318 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 242 Length adjustment: 24 Effective length of query: 223 Effective length of database: 218 Effective search space: 48614 Effective search space used: 48614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory