GapMind for catabolism of small carbon sources

 

Protein WP_011868438.1 in Methanococcus maripaludis C5

Annotation: NCBI__GCF_000016125.1:WP_011868438.1

Length: 389 amino acids

Source: GCF_000016125.1 in NCBI

Candidate for 24 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism proV med glycine betaine/l-proline transport atp-binding protein prov (characterized) 45% 95% 325.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-proline catabolism opuBA med BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 45% 93% 313.9 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 51% 95% 259.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 47% 96% 245 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 93% 154.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 93% 154.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-glutamate catabolism gltL lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 93% 154.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 34% 72% 153.7 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 96% 152.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-arginine catabolism artP lo AotP aka PA0892, component of Arginine/ornithine (but not lysine) porter (characterized) 38% 91% 148.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 38% 91% 147.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-lysine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 38% 91% 147.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 38% 86% 147.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 85% 144.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 85% 144.8 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 35% 96% 142.5 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-asparagine catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 36% 92% 142.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-aspartate catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 36% 92% 142.1 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 35% 91% 138.7 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 34% 77% 131.7 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 33% 84% 126.3 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 85% 123.6 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
2'-deoxyinosine catabolism nupA lo RnsB, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized) 31% 59% 117.9 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 82% 110.2 OtaA, component of The salt-induced glycine betaine OtaABC transporter 50% 359.0

Sequence Analysis Tools

View WP_011868438.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNDPIIQVTELYKIFGKKPEKAYPLIKEGFSRKEIKEKTKQVVGLKDINFDVKKGEIFVI
MGLSGSGKSTLIRCINRLIKPTYGKIVLENGVDISQMREKDLLEIRRKYFGMVFQKFGLL
PNRSVLENVALGLEIQGVGLEERIEKSEKALSLVGLKGWEKSKISELSGGMQQRVGLARG
LAVEPEILLMDEPFSALDPLIRLEMQELLLKIQKKMKKTIIFITHDLNEAIKLGDRIMIL
NEEGSLVQLSHPEEILLNPQNDFVESFVKEVDKTTVIRAESLVKKPEFTLNTRMEKEHAV
KILGDLSLEYAYVLDDSGKYLGVVSAEELQNSEQIMNCIQKIKPLEDVKTINQGLPQFIS
SDYPVPVVDDENNFLGYVEFEEVINLIKN

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory