Align arginine ABC transporter, periplasmic arginine-binding protein ArtJ (characterized)
to candidate WP_011869222.1 MMARC5_RS07485 basic amino acid ABC transporter substrate-binding protein
Query= CharProtDB::CH_002541 (243 letters) >NCBI__GCF_000016125.1:WP_011869222.1 Length = 260 Score = 159 bits (403), Expect = 4e-44 Identities = 97/262 (37%), Positives = 144/262 (54%), Gaps = 28/262 (10%) Query: 1 MKKLVLAALLASFTFGASAAEK--------------INFGVSATYPPFESIGANNEIVGF 46 +KKL+L L+ S + E + G T+PPFE A+ E+VGF Sbjct: 4 VKKLILLGLVVSLVAFSGCTEDQASAKGSMTMTEGILVVGTDPTFPPFEEKNADGELVGF 63 Query: 47 DIDLAKALCKQMQAECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYE 106 DIDL AL ++M E F FD +IP+LK K+D +IS + IT +R+K+V+FT Y++ Sbjct: 64 DIDLMNALGEKMGIEIQFVEQPFDGIIPALKAEKFDCIISAVTITDDRAKEVAFTNSYFD 123 Query: 107 NSAV--VIAKKDTYKTFADLKGKRIGMENGTT----HQKYIQDQHPEVKTVSYDSYQNAF 160 + V V+ D+ ++ DL GK + + GTT Q Y ++ E+K SY+ +AF Sbjct: 124 AAQVIAVLIDDDSVQSVDDLAGKVVAAQLGTTGEYEAQHYAEELGFEIK--SYEVMADAF 181 Query: 161 IDLKNGRIDGVFGDTAVVNEWLKTNPQL-GVATEKVTDPQYFGTGLGIAVRPDNKALLEK 219 ID++NGR++ V D V +L T P + V E +T Y G+A DN+ L++ Sbjct: 182 IDMENGRVNAVVTDDGVAQRFLDTKPGVYKVVGEPMTSESY-----GLAANLDNQELIDA 236 Query: 220 LNNALAAIKADGTYQKISDQWF 241 LNNALA +K DGTY +I +WF Sbjct: 237 LNNALAEVKEDGTYDEIYAEWF 258 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 260 Length adjustment: 24 Effective length of query: 219 Effective length of database: 236 Effective search space: 51684 Effective search space used: 51684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory