Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_011869221.1 MMARC5_RS07480 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_000016125.1:WP_011869221.1 Length = 226 Score = 109 bits (273), Expect = 4e-29 Identities = 69/210 (32%), Positives = 114/210 (54%), Gaps = 13/210 (6%) Query: 4 LWADLGPSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTP 63 L+ + P L+ +TIK+T++S I + GTIL R+S + R +S+ YI VR TP Sbjct: 13 LFIKIIPQLIDGSILTIKITVFSIIIGLFLGTILGMGRISYNIVYRYISSFYIEFVRGTP 72 Query: 64 LTLVVLFCSFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTV 123 L + ++ FGL + G+ L+ + +L L + +V E +++GI +V Sbjct: 73 LLVQIMIIYFGL-PSFGINLSA-----------YTAGILALGLNSGAYVGEIIKAGILSV 120 Query: 124 HFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLL 183 H GQ EAARSLG+ + R II PQA R + +GN I L K++++ SVI + E + + Sbjct: 121 HVGQMEAARSLGMNYAQAMRYIILPQAFRNVLPAIGNEFILLLKDSSLLSVIAIVELTRV 180 Query: 184 MKATIENHANMLFVVFAIFAVGFMILTLPM 213 K + N + + A+ ++I+TLP+ Sbjct: 181 GKQIYSSTYNAWTPLLGV-ALFYLIMTLPL 209 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 226 Length adjustment: 22 Effective length of query: 206 Effective length of database: 204 Effective search space: 42024 Effective search space used: 42024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory