Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate WP_011869082.1 MMARC5_RS06765 acetyl-CoA carboxylase biotin carboxylase subunit
Query= BRENDA::Q9I299 (655 letters) >NCBI__GCF_000016125.1:WP_011869082.1 Length = 497 Score = 420 bits (1079), Expect = e-122 Identities = 219/470 (46%), Positives = 313/470 (66%), Gaps = 5/470 (1%) Query: 9 QRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYLR 68 +++L+ANRGEIA RV+R+ + LGI +VAV S+ D H+ + AD +G + SYL Sbjct: 3 KKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSYLN 62 Query: 69 GDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKAL 128 +RI+ A +G A+HPGYGFLSEN FA C + G+ F+GPP AI+ MGSK AK Sbjct: 63 MERILKVAEKTGVDAVHPGYGFLSENVKFAEECNKRGIEFIGPPTNAINVMGSKINAKKA 122 Query: 129 MEEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEALS 188 M+ AGVP++PG + E A IGYPV++KA+AGGGG GM VV + EL + + Sbjct: 123 MKIAGVPVLPGREEPIESEEGAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELIDTIQ 182 Query: 189 SAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEEA 248 S + A++AFGD+ + +EKYL KPRH+EIQV AD+ G+ ++L +R+CSIQRRHQK++EE+ Sbjct: 183 STKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIEES 242 Query: 249 PAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDERGQFFFMEMNTRLQVEHPVTEA 308 P+P + +LR MG AAV+AA+AI Y GTVEFL G+F+F+EMNTR+QVEHP+TE Sbjct: 243 PSPIMTEDLREKMGTAAVKAAKAINYHSVGTVEFLY-SNGEFYFLEMNTRVQVEHPITEV 301 Query: 309 ITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYREAA 368 +TG+D+V QI++A G+ L Q+++ GHAIE R+ AED DF+P+ G++ YR + Sbjct: 302 VTGVDIVKEQIKIAAGKKLSYNQDEISFRGHAIECRVNAEDAINDFVPSPGKIKYYR-SP 360 Query: 369 AGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNLAF 428 GPG R+DSGV G E+ P+YD M+AK+I +G TREEA +R+ L+E V G+ TN+ F Sbjct: 361 GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYIVLGIITNIPF 420 Query: 429 LRRILGHPAFAAAELDTGFIARHQDDLLPAPQALPEHFWQAAAEAWLQSE 478 R ++ F L T ++ +D+L +A+ + +A + SE Sbjct: 421 HRAVIEEDNFLKGNLSTHYV---EDNLCSFRKAMLNYALEAKDREKIFSE 467 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 685 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 497 Length adjustment: 36 Effective length of query: 619 Effective length of database: 461 Effective search space: 285359 Effective search space used: 285359 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory