Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_011867836.1 MMARC5_RS00300 ATP-binding cassette domain-containing protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000016125.1:WP_011867836.1 Length = 312 Score = 105 bits (263), Expect = 8e-28 Identities = 67/194 (34%), Positives = 111/194 (57%), Gaps = 7/194 (3%) Query: 21 LQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVRR 80 L+ +N I + ++GP+GAGKS + + I G+L P G I F GE+IT + + +R Sbjct: 16 LKSVNLDIDDNYCI-LLGPSGAGKSVIIQCITGILKPDSGRIYFDGEDITDIPPE---KR 71 Query: 81 GMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTM--FPKLAQRRNQRAGTLS 138 YVPQ +F + V N+ G L + P ++ +I + F K+ N++ TLS Sbjct: 72 NFGYVPQNYALFPHMNVYNNIAYGMKLRKCPKLEIEKKITEIAEFLKITHILNRKPTTLS 131 Query: 139 GGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQNAKQ 198 GGE+Q +A+ RAL+LDP +LLLDEP++AL + ++V +++K I II + + + Sbjct: 132 GGEQQRVAIARALVLDPKILLLDEPTSALDTNIKENVISELKRIGEL-VPIIHITHDFVE 190 Query: 199 ALMMADRGYVLENG 212 A + ++ +L NG Sbjct: 191 AKTLGNQIAILING 204 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 312 Length adjustment: 25 Effective length of query: 215 Effective length of database: 287 Effective search space: 61705 Effective search space used: 61705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory