GapMind for catabolism of small carbon sources

 

Protein WP_012568847.1 in Rhodospirillum centenum SW SW; ATCC 51521

Annotation: NCBI__GCF_000016185.1:WP_012568847.1

Length: 277 amino acids

Source: GCF_000016185.1 in NCBI

Candidate for 27 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism thuG hi ABC transporter for D-Trehalose, permease component 2 (characterized) 70% 97% 387.9 PalG, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 58% 326.6
sucrose catabolism thuG hi ABC transporter for D-Trehalose, permease component 2 (characterized) 70% 97% 387.9 PalG, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 58% 326.6
trehalose catabolism thuG hi ABC transporter for D-Trehalose, permease component 2 (characterized) 70% 97% 387.9 PalG, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 58% 326.6
xylitol catabolism Dshi_0549 lo ABC transporter for Xylitol, permease component 2 (characterized) 35% 99% 179.1 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-cellobiose catabolism msdB2 lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 33% 97% 174.9 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism malG_Bb lo ABC-type Maltose/ Maltodextrin permease (characterized, see rationale) 32% 97% 164.9 ABC transporter for D-Trehalose, permease component 2 70% 387.9
L-fucose catabolism SM_b21105 lo ABC transporter for L-Fucose, permease component 2 (characterized) 31% 98% 162.2 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-cellobiose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-glucose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
lactose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-mannose catabolism TT_C0326 lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
sucrose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
trehalose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 33% 100% 157.5 ABC transporter for D-Trehalose, permease component 2 70% 387.9
N-acetyl-D-glucosamine catabolism SMc02871 lo ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized) 36% 95% 156 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-glucosamine (chitosamine) catabolism SMc02871 lo ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized) 36% 95% 156 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-mannitol catabolism mtlG lo MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 31% 99% 153.7 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-sorbitol (glucitol) catabolism mtlG lo MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 31% 99% 153.7 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism malG_Sm lo MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 100% 151.8 ABC transporter for D-Trehalose, permease component 2 70% 387.9
trehalose catabolism malG lo MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 100% 151.8 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism malG_Aa lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 31% 91% 151.4 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-glucosamine (chitosamine) catabolism SM_b21219 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 33% 100% 143.3 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-cellobiose catabolism cebG lo CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 35% 95% 137.9 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism malG lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 34% 95% 127.9 ABC transporter for D-Trehalose, permease component 2 70% 387.9
D-maltose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 33% 68% 126.7 ABC transporter for D-Trehalose, permease component 2 70% 387.9
sucrose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 33% 68% 126.7 ABC transporter for D-Trehalose, permease component 2 70% 387.9
trehalose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 33% 68% 126.7 ABC transporter for D-Trehalose, permease component 2 70% 387.9

Sequence Analysis Tools

View WP_012568847.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MRVKRQIGQALFYVLVAVLLLYTLFPFYWAIVSSLRSGQALFSTDLIPTDPVWENYAAVF
REQPFARNILNSVIVAVSVVALSLLLSLTAAYSLGRVRFRGRGFLLMVVLAVSMFPQVAV
LSGLFELVRILGLYNSLTSLILSYLIFTLPFTVWVLATFMRELPKELEEAALVDGASPWV
ILTRVFLPLMWPAMVTTGLLAFIAAWNEFLFALTFTLSNEMRTVPVAIALITGASQYELP
WGRVMAASVIVTVPLIVLVLIFQRRIVAGLTAGAVKG

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory