Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_012565610.1 RC1_RS01780 acyl-CoA dehydrogenase family protein
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_000016185.1:WP_012565610.1 Length = 383 Score = 134 bits (337), Expect = 4e-36 Identities = 112/378 (29%), Positives = 177/378 (46%), Gaps = 18/378 (4%) Query: 19 LTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGL 78 +TE+ R+ D+A +F + + AP D ++ GE GLL A++PE+YGG+G Sbjct: 10 MTEDLRIFHDAALKFFERECAPHAKRWDEQGVVDREVWTRAGEAGLLCASMPEEYGGAGG 69 Query: 79 NYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFG 138 ++ ++ + +G+ + S+ + +V I +G+E QK+++LP+LASGE +G Sbjct: 70 DFAHEAVLIDARMKAGAGHFGI-SLHNGIVAPYILHYGSEEQKRRWLPRLASGELVGAIA 128 Query: 139 LTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAK-DDAGDIRG---- 193 +TEP GSD + T AR Y L GSK +ITN A++ +V AK D A +G Sbjct: 129 MTEPGTGSDLQGVRTSARLDGNQYVLNGSKTFITNGQTANLIIVVAKTDPAAGAKGTSLI 188 Query: 194 FVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGL--KGPFTCLNSA 251 V G K+GL+ T E+ D+V VP ++ GL L Sbjct: 189 VVETDAVDGFRRGRNLDKIGLKGQDTSELFFDDVRVPTSSLLGPQPGLGFVQLMQQLPQE 248 Query: 252 RYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGC--- 308 R I+ AL EA Y R+ FG+ + Q + LA TE+ +A C Sbjct: 249 RLIIALEALAGIEAGIAATLDYVKQRKAFGQRIIDFQNTRFTLAQAVTEMRVARAFCDDC 308 Query: 309 --LRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLE 366 L D TAA+ + +R C D ++ GG G +E+ +AR + Sbjct: 309 TERHLKGELDAATAAMAKLWLTER-QCAILDDCLQLH----GGYGYMNEYPIARLWADAR 363 Query: 367 VVNTYEGTHDVHALILGR 384 V Y GT+++ ++GR Sbjct: 364 VGKIYGGTNEIMKELIGR 381 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 383 Length adjustment: 30 Effective length of query: 363 Effective length of database: 353 Effective search space: 128139 Effective search space used: 128139 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory