Align serine racemase (EC 5.1.1.18) (characterized)
to candidate WP_012568310.1 RC1_RS15150 threonine ammonia-lyase
Query= BRENDA::Q2PGG3 (331 letters) >NCBI__GCF_000016185.1:WP_012568310.1 Length = 427 Score = 207 bits (526), Expect = 5e-58 Identities = 116/312 (37%), Positives = 187/312 (59%), Gaps = 20/312 (6%) Query: 15 IKEAHDRIKPYIHRTPVLTSESLNSISGRSLFFKCECLQKGGAFKFRGACNAVLSLDAEQ 74 I+ A + ++ + TP + S +L+ I+G ++ K E LQ +FK RGA N + +L E+ Sbjct: 31 IRAAAEALRGQVVETPCIPSRTLSQITGAEIWVKFENLQFTASFKERGAFNKLRTLTEEE 90 Query: 75 AAKGVVTHSSGNHAAALSLAAKIQGIPAYIVVPKGAPKCKVDNVIRYGGKVIWSEATMSS 134 +GVV S+GNHA ++ A G+PA IV+P+G P KV++ +G +V+ A + Sbjct: 91 RRRGVVAMSAGNHAQGVAYHAGRLGVPATIVMPEGTPFVKVEHTENFGARVVLKGANLGE 150 Query: 135 REEIASKVLQETGSVLIHPYNDGRIISGQGTIALELLEQIQEIDAIVVPISGGGLISGVA 194 + A ++++E G VL+HPY+D +I+GQGT+ALE+L +++ +VVP+ GGGLISG+A Sbjct: 151 SQIEAERLVREEGLVLVHPYDDAEVIAGQGTVALEMLAAAPDLEVLVVPVGGGGLISGIA 210 Query: 195 LAAKSIKPSIRIIAAEPKGADDAAQS------KVAGKIITLPVTNTIADGLRA-SLGDLT 247 AAK++KP I ++ E + AQ+ V G +TIA+G+ ++G LT Sbjct: 211 TAAKAVKPDIEVVGVEVEAYAAVAQALRGEPPHVGG--------DTIAEGIAVKNVGRLT 262 Query: 248 WPVVRDLVDDVVTLEECEIIEAMKMCYEILKVSVEPSGAIGLAAVLSNSFRNNPSCRDCK 307 ++R LVD+V+ + + E+ A+ + I K E +GA GLAAVL N+P + Sbjct: 263 LQIIRALVDEVMLVPDAEVERAVALFLNIEKTVAEGAGAAGLAAVL-----NHPERFQGR 317 Query: 308 NIGIVLSGGNVD 319 +G+VL GGN+D Sbjct: 318 KVGLVLCGGNID 329 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 427 Length adjustment: 30 Effective length of query: 301 Effective length of database: 397 Effective search space: 119497 Effective search space used: 119497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory