Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_012567848.1 RC1_RS12905 enoyl-CoA hydratase-related protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000016185.1:WP_012567848.1 Length = 276 Score = 160 bits (406), Expect = 2e-44 Identities = 90/250 (36%), Positives = 141/250 (56%), Gaps = 7/250 (2%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADIT---QFNQ- 72 ITLNRPD++N ++ +L+ L + +A+ DP +RV+++TG G+AFCAG D+ QF Sbjct: 27 ITLNRPDRMNTISGPMLDRLAELLLRADRDPAVRVVVLTGSGRAFCAGLDLRTGLQFEAG 86 Query: 73 ---LTPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQL 129 + P+ R + A+ KPTI +NG A G G++LAL CD+R+ A A+L Sbjct: 87 DGPVAPSATPTSIDLTRSPPTVLHAMDKPTICAVNGAAAGYGMDLALGCDLRVMAASAKL 146 Query: 130 GLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQ 189 G+ P G T L R++G A E++ TG +P ++A+ GLV RVVP A+L Sbjct: 147 SAAFCRRGVLPESGSTWLLPRMVGWETAAELIFTGRVLPAEEAKALGLVGRVVPDADLPA 206 Query: 190 ETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFL 249 LA +IA +P+++ K ++ G + + + + +T D +EG++AFL Sbjct: 207 AVAALAREIADNAPLAVQASKRMMRMGQNQTFPDHVHHVYLQLLTLVATADFREGMAAFL 266 Query: 250 EKREPTFKGK 259 EKR P FKG+ Sbjct: 267 EKRRPAFKGR 276 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 276 Length adjustment: 25 Effective length of query: 234 Effective length of database: 251 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory