Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_012568400.1 RC1_RS15600 NADP-dependent malic enzyme
Query= curated2:Q8CJR5 (697 letters) >NCBI__GCF_000016185.1:WP_012568400.1 Length = 756 Score = 149 bits (376), Expect = 5e-40 Identities = 112/367 (30%), Positives = 171/367 (46%), Gaps = 12/367 (3%) Query: 325 KLGAATPRKAETALGLFERYVDTAELNKRVSA---PSSDRVTPMMFEHKLLEQARSDLRR 381 K+ AA R A + + VD E + + P+SD + + E+ ++ +R Sbjct: 394 KIPAAVARAAMESGVARKPIVDMEEYGRSLRLRLDPTSDSL------QLIFEKVKATPKR 447 Query: 382 VVLPEGTEERVLHAAEVLLRRGVCELTLLGPVEQIRKKAADLGI-DLGGAELIDPAASEL 440 VV EG EER + AA G L+G E I ++ A LG+ + E+ + S+L Sbjct: 448 VVFAEGEEERTIRAALAFRTAGYGTPVLIGREEVIIEQIASLGLGSIEPLEIHNARVSQL 507 Query: 441 RDSFAEKYAALRAHKGVTVELAYDVVS-DVNYFGTLMVQEGFADGMVSGSVHSTAATIRP 499 D F++ +G+ +V+ + N FG MV G AD +V+G S A + Sbjct: 508 NDGFSDFLYGRLQRRGMLYRDCQRLVNQNRNVFGACMVALGAADALVTGLTRSFAVSFED 567 Query: 500 AFEIIKTKPDAAIVSSVFFMCLADKVLVYGDCAVNPDPDAEQLADIATQSASTAAQFGVE 559 ++ +PD + A V + D V+ P AE+LADIA QSA TA Q G E Sbjct: 568 IARVVDPQPDHVVFGLSVLASRARTVFI-ADTTVHEQPRAEELADIAIQSARTARQMGHE 626 Query: 560 PRIAMLSYSTGTSGSGADVDKVREATELVRSRRPDLSVEGPIQYDAAVEPSVAATKLPGS 619 PR+A LS+S VR+A L+ R D +G + D A++ + + P Sbjct: 627 PRVAFLSFSNFGQPMHQRAQHVRDAVALLDGRSVDFEYDGEMSADVALDFELMSRLYPFC 686 Query: 620 AVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVLQGLRKPVNDLSRGALVQDIVNTV 679 ++G A+VLI P L+ N K +Q+ G VGP+L GL +PV + GA D+V Sbjct: 687 RLSGPANVLIMPGLHAANIGAKMLQKMGGGTLVGPLLIGLDRPVQIVQMGATANDMVTAA 746 Query: 680 AITAIQA 686 + A A Sbjct: 747 VLAAHDA 753 Lambda K H 0.318 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1168 Number of extensions: 56 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 697 Length of database: 756 Length adjustment: 40 Effective length of query: 657 Effective length of database: 716 Effective search space: 470412 Effective search space used: 470412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory