Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_011883164.1 enoyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000016205.1:WP_011883164.1 Length = 258 Score = 199 bits (506), Expect = 5e-56 Identities = 109/259 (42%), Positives = 159/259 (61%), Gaps = 1/259 (0%) Query: 1 MEFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKA 60 M +E I + G + ITLNRP LNALN L++EL A+ ++D EI I++TG KA Sbjct: 1 MSYENILVETRGRVGLITLNRPKALNALNDALMDELGAALKAFDADDEIGAIVVTGSEKA 60 Query: 61 FCAGADITQFNQLTPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDI 120 F AGADI + + ++ R + + + KP IA + G+ALGGG ELA+ CDI Sbjct: 61 FAAGADIGMMATYSYMDVYRGDYITRN-WETVREIRKPIIAAVAGFALGGGCELAMMCDI 119 Query: 121 RIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNR 180 AA+ A+ G PEI LG+ PG GGTQRL R + K +A++M +T + +AE+ GLV+R Sbjct: 120 IFAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMDAAEAERAGLVSR 179 Query: 181 VVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTED 240 V+P L E A IA+ S ++ ++KE VNR ++ L G+ E + +F+TED Sbjct: 180 VLPADKLLDEAVAAATTIAEFSLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATED 239 Query: 241 KKEGVSAFLEKREPTFKGK 259 +KEG++AF+EKR+P FK + Sbjct: 240 QKEGMAAFVEKRKPVFKNR 258 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory