Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011885760.1 ABC transporter ATP-binding protein
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000016205.1:WP_011885760.1 Length = 389 Score = 441 bits (1135), Expect = e-128 Identities = 222/355 (62%), Positives = 275/355 (77%), Gaps = 6/355 (1%) Query: 2 KNTKTNWIIG---AVALLVLPLILQSFG-NAWVRIADLALLYVLLALGLNIVVGYAGLLD 57 +NT +IG A ++ P+I+ S G N WVR+ D A+LYV+LALGLN+VVG+AGLLD Sbjct: 17 RNTTKTVLIGILTAAFVIAAPIIIGSAGGNYWVRVLDFAMLYVMLALGLNVVVGFAGLLD 76 Query: 58 LGYVAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLG 117 LGY+AFYAVGAY AL++SPHL F AA+ PNGLH I++P+A LAA FG +LG Sbjct: 77 LGYIAFYAVGAYTAALLSSPHLTSQFEWIAALAPNGLHIPFLIIVPIAMALAATFGILLG 136 Query: 118 APTLKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLE 177 APTL+LRGDYLAIVTLGFGEI+RIF+NNLD PVN+TNGPKG+ ID V + G +L + Sbjct: 137 APTLRLRGDYLAIVTLGFGEIVRIFMNNLDRPVNITNGPKGITGIDPVHIGGFNLSQTHS 196 Query: 178 VFGFDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMK 237 +FGF + SV +YYYLF++ ++ + +C RLQ SRIGRAW AIREDEIAAKAMGINTRN+K Sbjct: 197 LFGFQLPSVYMYYYLFVLCSLLVIWVCTRLQHSRIGRAWAAIREDEIAAKAMGINTRNVK 256 Query: 238 LLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLL 297 LLAF MGASFGG+SGAMFGAFQGFVSPESF+ ES++++A VVLGG+GHIPGVILGAVLL Sbjct: 257 LLAFAMGASFGGLSGAMFGAFQGFVSPESFTFWESIVVLACVVLGGMGHIPGVILGAVLL 316 Query: 298 SALPEVLRYVAGPLQAMTDGR--LDSAILRQLLIALAMIIIMLLRPRGLWPSPEH 350 + PE LR PLQ G +D+ ++RQ L LAM++IML R GLWP+P+H Sbjct: 317 AIFPEFLRSTMSPLQHALFGHDIVDTEVIRQALYGLAMVVIMLYRSEGLWPAPKH 371 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 389 Length adjustment: 30 Effective length of query: 328 Effective length of database: 359 Effective search space: 117752 Effective search space used: 117752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory