Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_011881868.1 3-hydroxybutyryl-CoA dehydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000016205.1:WP_011881868.1 Length = 261 Score = 207 bits (526), Expect = 2e-58 Identities = 117/258 (45%), Positives = 160/258 (62%), Gaps = 2/258 (0%) Query: 3 YENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EKAF 61 ++NI E + + VT++RPK+LNALN + E+ AA + DDA+ ++VTGS KAF Sbjct: 4 FQNIQYEKKSGIAYVTVDRPKSLNALNFQTLTEITAAFEDARDDDAVHGVIVTGSGNKAF 63 Query: 62 AAGADIGMMSTYTYMDVYKGDYITRN-WETVRSIRKPIIAAVAGFALGGGCELAMMCDII 120 AGADI ++ + + K + + + ++ KP+IAAV GFALGGGCELAM C + Sbjct: 64 VAGADISEIAALSAVAAEKFAGLGHSTMNLIETLGKPVIAAVNGFALGGGCELAMACTMR 123 Query: 121 FAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRV 180 A++ AKFGQPE+KLGI+PG GGTQRLPR V K AM L LTA +DA EA R GLV+ V Sbjct: 124 IASEHAKFGQPEVKLGIIPGFGGTQRLPRLVGKGIAMQLILTAALIDANEAHRIGLVNEV 183 Query: 181 IPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ 240 + A L+ A IA A + +VN+ E +L + + ER LF ATED+ Sbjct: 184 VEADKLIARAEQILNQIAANAPIATRLAITAVNQGVEASLEQALSLERALFAVCAATEDK 243 Query: 241 KEGMAAFVEKRKPVFKHR 258 EG AAF++KR P F+ + Sbjct: 244 AEGTAAFLDKRAPTFQSK 261 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory