GapMind for catabolism of small carbon sources

 

Alignments for a candidate for gcvH in Clostridium kluyveri DSM 555

Align Glycine cleavage system H protein; Octanoyl/lipoyl carrier protein (characterized)
to candidate WP_012102168.1 CKL_RS08710 glycine cleavage system protein GcvH

Query= SwissProt::P64213
         (126 letters)



>NCBI__GCF_000016505.1:WP_012102168.1
          Length = 126

 Score =  142 bits (359), Expect = 1e-39
 Identities = 71/125 (56%), Positives = 93/125 (74%), Gaps = 5/125 (4%)

Query: 1   MAVPNELKYSKEHEWVKVEGNVATIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVE 60
           M  P EL Y++ HEWVK+EG+ A +G+T+YAQSELGD+VFV LPE  DE+  G+ F  VE
Sbjct: 1   MNFPKELMYTESHEWVKIEGDKALVGLTDYAQSELGDLVFVNLPEEGDEVTAGEVFLDVE 60

Query: 61  SVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKV-EISDESQLEALLTAEK 119
           SVK  S++YAP+ G + EVNEEL D P ++NE+PYE AW+VK+ EISD    E LLTAE+
Sbjct: 61  SVKAASDVYAPLGGVIEEVNEELLDRPGWINEAPYE-AWLVKIGEISDR---EKLLTAEE 116

Query: 120 YSEMI 124
           Y  ++
Sbjct: 117 YEAVV 121


Lambda     K      H
   0.305    0.127    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 100
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 126
Length of database: 126
Length adjustment: 14
Effective length of query: 112
Effective length of database: 112
Effective search space:    12544
Effective search space used:    12544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.0 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory