Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_011940062.1 GURA_RS16470 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000016745.1:WP_011940062.1 Length = 223 Score = 141 bits (356), Expect = 1e-38 Identities = 84/210 (40%), Positives = 126/210 (60%), Gaps = 17/210 (8%) Query: 4 LEVQDLHKRYGSH----EVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGK 59 LEV+DL+K YG+ EVL+G+SL AG+ I+++G+SG+GKST L + ++ P +G Sbjct: 5 LEVRDLYKSYGTGAAKVEVLRGISLNVTAGETIALVGASGAGKSTLLHVLGTIDTPTSGT 64 Query: 60 ILLNNEELKLVANKDGALKAADPKQLQRMRSR-LSMVFQHFNLWSHMTAMENIMEAPVHV 118 +L N EE+ + L R+R + VFQ +L +A+EN M P+ + Sbjct: 65 VLFNGEEIFRLGGM----------ALAAFRNRSIGFVFQFHHLLPEFSALENAM-MPLLI 113 Query: 119 LGMSKAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTS 178 GM + EA AE L VG+SHR PG +SGGEQQRVAIAR+L P+++L DEPT Sbjct: 114 GGMKRGEAEAIAEELLRDVGLSHRLTHKPGELSGGEQQRVAIARSLVRSPKLLLADEPTG 173 Query: 179 ALDPELVGDVLKVMQAL-AQEGRTMVVVTH 207 LD + +V ++ + ++G T+++VTH Sbjct: 174 NLDMKTSDEVHDLLNEIHRKKGLTLIIVTH 203 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 223 Length adjustment: 23 Effective length of query: 231 Effective length of database: 200 Effective search space: 46200 Effective search space used: 46200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory