Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_011939123.1 GURA_RS11390 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= reanno::SB2B:6938540 (460 letters) >NCBI__GCF_000016745.1:WP_011939123.1 Length = 455 Score = 252 bits (643), Expect = 2e-71 Identities = 149/441 (33%), Positives = 251/441 (56%), Gaps = 17/441 (3%) Query: 12 LQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRK 71 LQ D + HPFT + + VIER EG +I D+ GN+ LD +A +W G+ +K Sbjct: 9 LQEYDRRYVWHPFTQMKEWEEEAPLVIERGEGSFIIDSDGNRYLDGVAAIWTNVHGHCKK 68 Query: 72 SIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNLR 131 I +A AQ+ L ++ T++ A LA ++ +AP +N+VF++ +GS A + ++ Sbjct: 69 EINEAIKAQVDRLE-HSTLLGLTNDKAALLAKRLVEIAPPGLNKVFYSDNGSTAVEIGVK 127 Query: 132 MVRRYWDLKG--MPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHIDQPY 189 M ++ +G K IS NAYHG TV S+GG+ H+ + + PY Sbjct: 128 MAFQFQQHRGGRFARKTRFISFTNAYHGDTVGAMSVGGIDIYHEVYSPLLFSTIKSPAPY 187 Query: 190 WFG----EGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPF-QGAGGVIIPPDSYW 244 + G+D S G+ + LE +++ D++A + EP QGAGG+I+ P + Sbjct: 188 CYRCRLCAGKDES--TCGLLCLKELE-RLMAAHADELAGLVIEPLVQGAGGMIVQPAGFV 244 Query: 245 NEIKRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIV 304 +++ + +KY+IL I DEV GFGRTG FA + G+ PD++ ++KG+T+GY+P+ + Sbjct: 245 RKVRELCDKYDILMIADEVAVGFGRTGAMFACEKEGITPDIMALSKGITAGYLPLAATLT 304 Query: 305 SDRVADVLISDGGE---FAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQD 361 + RV D + + E F HG T++G+P+A A AL ++ + E+E+L+ ++ YL+ Sbjct: 305 TQRVYDAFLGEYKELKTFFHGHTFTGNPIACAAALASLDLFEKEQLLSNLQPKI-DYLKK 363 Query: 362 RLQTLSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGM-LCREACIESGLVMRAV 420 RL +L VG++R GM+G IELV DK + + E G+ +C+EA + GL +R + Sbjct: 364 RLSSLKQLDHVGDIRQEGMLGGIELVRDKETREPYPWEERIGVQVCKEA-RKHGLFLRPL 422 Query: 421 GDTMIISPPLCITRDEIDELI 441 G+ +++ PPL I+ E+++L+ Sbjct: 423 GNVIVVFPPLSISLSELEQLM 443 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 455 Length adjustment: 33 Effective length of query: 427 Effective length of database: 422 Effective search space: 180194 Effective search space used: 180194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory