Align Proline dehydrogenase; PRODH; DrPRODH; Proline oxidase; EC 1.5.5.2 (characterized)
to candidate WP_011938764.1 GURA_RS09480 L-glutamate gamma-semialdehyde dehydrogenase
Query= SwissProt::Q9RW55 (310 letters) >NCBI__GCF_000016745.1:WP_011938764.1 Length = 1002 Score = 116 bits (291), Expect = 2e-30 Identities = 103/347 (29%), Positives = 160/347 (46%), Gaps = 53/347 (15%) Query: 9 AVLTVAERPQVEQLARQKMWNLAERFVAGESIESAIQAVQALERDGIAGNLDLLGEFIDS 68 AVL A + ++ARQ F+ GES + ++ ++ L +DG A +D+LGE S Sbjct: 101 AVLNKALSSNIHEMARQ--------FIIGESCKETVKNLEKLRKDGFAFVVDVLGEATLS 152 Query: 69 PAKCTEFADDVIKLIEA----------------------AHAAGIKPYV-SIKLSSVGQG 105 A+ + + + L+++ HA I V + L + Sbjct: 153 EAEAEAYVNTYLDLLDSLQKEQGGWKGLPGRGGDPALDWGHAPKINVAVKATALYCLANP 212 Query: 106 KDENGEDLGLTNA-RRIIAKAKEYGGFICLDMEDHTRVDVTLEQFRTLVGEF-GAEHVGT 163 +D G + + N RRI A+ GF+CLDME + D+ LE FR L E H+G Sbjct: 213 QDFEGSVVAILNRLRRIFARVAAVNGFLCLDMESYRFKDIILEVFRRLRLEHRDYPHLGI 272 Query: 164 VLQSYLY---RSLGDR---ASLDDLRPNIRMVKGAYLEPATV----------AYPDKADV 207 VLQSYL R L D A ++++ +IR+VKGAY + TV + KA+ Sbjct: 273 VLQSYLKDTDRDLDDLLGWARMNNVPLSIRLVKGAYWDYETVRTRQNNWAVPVWTIKAET 332 Query: 208 DQNYRRLVFQHLK--AGNYTNVATHDERIIDDVKRFVLAHGIGKDAFEFQMLYGIRRDLQ 265 D Y R + L+ A + A+H+ R I V + ++ +EFQ+LYG+ ++ Sbjct: 333 DAAYERQARKILENHAVCHFACASHNIRTISAVMEMAGELSVPEERYEFQLLYGMAEPVR 392 Query: 266 KQLAAEGYRVRVYLPYGR--DWYAYFSRRIAETPRNAAFVVQGMLKG 310 K + RVR+Y PYG Y RR+ E N +F+ Q +G Sbjct: 393 KAILKVAGRVRLYCPYGNMVPGMGYLVRRLLENTANESFLRQTFAEG 439 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 48 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 1002 Length adjustment: 36 Effective length of query: 274 Effective length of database: 966 Effective search space: 264684 Effective search space used: 264684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory