Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_011937970.1 GURA_RS05265 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000016745.1:WP_011937970.1 Length = 248 Score = 155 bits (393), Expect = 8e-43 Identities = 85/229 (37%), Positives = 139/229 (60%), Gaps = 5/229 (2%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M++++ NV K F G V L+ +N+ I +G+ ++GPSG GK+ ++ + GL P G Sbjct: 1 MIKLV--NVEKSF--GSQVVLNKLNLEIPHGKITAVIGPSGEGKSVLLKHMIGLLRPDRG 56 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNM-KMSKEEIRK 119 + D + G+ + K GM+FQ AL+ ++T FEN+AFPL ++S+ EI Sbjct: 57 AVIVDGEDITGMGRDRLNHVREKFGMLFQNAALFDSMTVFENVAFPLEEKTRLSRTEIAA 116 Query: 120 RVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSA 179 RV E + + + V FP ELSGG ++RV LARA++ DP ++L DEP + LD + + Sbjct: 117 RVHEALEHVGLKGVDKKFPDELSGGMKKRVGLARAVLLDPKIILFDEPTTGLDPIICRAT 176 Query: 180 RALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDL 228 L+K+ R G T +VVSH+ +IF ++D V +L +G++++VG PE++ Sbjct: 177 HQLIKDTHVRFGFTAVVVSHEIPEIFDVSDFVAMLYRGEILEVGTPEEI 225 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 248 Length adjustment: 26 Effective length of query: 327 Effective length of database: 222 Effective search space: 72594 Effective search space used: 72594 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory