Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_011937970.1 GURA_RS05265 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000016745.1:WP_011937970.1 Length = 248 Score = 148 bits (374), Expect = 1e-40 Identities = 85/218 (38%), Positives = 127/218 (58%), Gaps = 2/218 (0%) Query: 43 GCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMD 102 G V +N L+L I G+I ++G SG GKS L++H L+ P GA++VDGEDI + D Sbjct: 12 GSQVVLNKLNLEIPHGKITAVIGPSGEGKSVLLKHMIGLLRPDRGAVIVDGEDITGMGRD 71 Query: 103 ALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGE-SKQVCAERALHWINTVGLKGY 161 L R K M+FQ+ L +V +NVA+ L+ + S+ A R + VGLKG Sbjct: 72 RLNHVRE-KFGMLFQNAALFDSMTVFENVAFPLEEKTRLSRTEIAARVHEALEHVGLKGV 130 Query: 162 ENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKT 221 + K+P +LSGGM++RVGLARA+ D IIL DE + LDP+I + + T Sbjct: 131 DKKFPDELSGGMKKRVGLARAVLLDPKIILFDEPTTGLDPIICRATHQLIKDTHVRFGFT 190 Query: 222 IVFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHS 259 V ++H++ E + + +A+L G++++VGTP EI S Sbjct: 191 AVVVSHEIPEIFDVSDFVAMLYRGEILEVGTPEEIQRS 228 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 248 Length adjustment: 25 Effective length of query: 251 Effective length of database: 223 Effective search space: 55973 Effective search space used: 55973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory