Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_011940671.1 GURA_RS19730 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000016745.1:WP_011940671.1 Length = 297 Score = 158 bits (400), Expect = 1e-43 Identities = 93/251 (37%), Positives = 147/251 (58%), Gaps = 27/251 (10%) Query: 7 SKIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGL 66 SKI ++N+ +++ R+ K+ +V +E ++++++ + GE I+G Sbjct: 17 SKIILENISQVY-----------RRKKSNGEVPSE---FTALSNINMKVKKGEFVAIVGP 62 Query: 67 SGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKS 126 SG GKSTL+ L P SG I +DG+ I +D +V Q + L P ++ Sbjct: 63 SGCGKSTLLDILAGLTRPASGEIHIDGKKITGPALDR---------GIVLQGYALFPWRT 113 Query: 127 VLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAAD 186 V NV +GL+V+ K+ + + H+I VGL G+EN+YP +LSGGM+QRV +ARALA D Sbjct: 114 VRRNVEFGLEVKNVPKEERKDISQHFIRLVGLDGFENRYPLELSGGMKQRVAIARALAYD 173 Query: 187 TDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDGK 246 +++LMDE F+A+D R +QD+LL + KTI+F+TH +DEAV + +R+A+L Sbjct: 174 PEVLLMDEPFAAVDAQTRETLQDELLRIWDETKKTIIFVTHSIDEAVYLADRVAVLTTNP 233 Query: 247 LIQVGTPREIL 257 GT REI+ Sbjct: 234 ----GTIREIV 240 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 297 Length adjustment: 26 Effective length of query: 250 Effective length of database: 271 Effective search space: 67750 Effective search space used: 67750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory