Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_011939224.1 GURA_RS11950 acyl-CoA dehydrogenase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_1146 (375 letters) >NCBI__GCF_000016745.1:WP_011939224.1 Length = 381 Score = 246 bits (629), Expect = 6e-70 Identities = 140/371 (37%), Positives = 213/371 (57%), Gaps = 2/371 (0%) Query: 4 TEEQTQIRDMARQFAEERLKPFAAEWDREHRFPREAIDEMAELGFFGMLVPEQWGGCDTG 63 TE+Q ++ A +FAE+ L A E +R F ++ ++ AE G + +PE++GG Sbjct: 6 TEDQLTFKNSAIEFAEKALNKGAKERERNCEFNQDGWEKCAEFGIQRLPIPEEYGGLGVD 65 Query: 64 YLAYAMTLEEIAAGDGACSTIMSVHNSVGCV--PILKFGNDEQKAKFLTPLASGAMLGAF 121 L T+E + G + ++++ + PILKFG D QK K+L L +G++ G Sbjct: 66 ILTCVATMEGLGYGCRDSGLLFAINSHIWTCESPILKFGTDYQKKKYLPGLCNGSLKGGH 125 Query: 122 ALTEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISA 181 A+TEP +GSDA S+K +A +GD Y++NG K FIT+ A +++VFAVTD G GIS Sbjct: 126 AMTEPDSGSDAFSMKCKAEKKGDRYIINGTKMFITNAPIADILLVFAVTDAKKGFAGIST 185 Query: 182 FIVPTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLGEEGEGYKIALANLEGGR 241 FIV PG+SV + D +G +++ +D +VP NRLG+EG G I + +E R Sbjct: 186 FIVEKGFPGFSVGKPLDMMGLKTCPLGEVILQDCEVPEENRLGKEGAGAAIFNSEMEWER 245 Query: 242 VGIAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAA 301 + A VG E Y +R F KPI ++QA++ ++ADM ++ ++R +++ A Sbjct: 246 SCLFATHVGAMGRDLEECIRYVNDRHQFEKPIGKYQAISHKIADMQVRLELSRLVLYKVA 305 Query: 302 ALRDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYE 361 L+ GQ A VE+++AKLF SE + C ALQ G YGY + ER RD +IY Sbjct: 306 WLKAQGQRAPVESAIAKLFVSESYVENCMEALQIHGAYGYSAEMDFERNLRDSIAGKIYS 365 Query: 362 GTSDIQRMVIS 372 GTS+IQ+ VI+ Sbjct: 366 GTSEIQKNVIA 376 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 381 Length adjustment: 30 Effective length of query: 345 Effective length of database: 351 Effective search space: 121095 Effective search space used: 121095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory