Align Short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_011939875.1 GURA_RS15455 acyl-CoA dehydrogenase family protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2983 (375 letters) >NCBI__GCF_000016745.1:WP_011939875.1 Length = 385 Score = 300 bits (768), Expect = 4e-86 Identities = 164/375 (43%), Positives = 244/375 (65%), Gaps = 5/375 (1%) Query: 5 DDQQQIRDMARDFAQERLKPFAAEWDREHRFPK--EAIGEMAGLGFFGMLVPEQWGGCDT 62 ++Q+ I++ ARDFA+ L+P AA DRE P + ++A LGF G+ V E++ G Sbjct: 7 EEQKLIQETARDFARAELEPVAARLDREGDRPAFLNNLRKLAELGFMGLNVKEEYCGAAA 66 Query: 63 GYLAYAMALEEIAAGDGACSTIMSVHNSVGCVPILNYGTDEQKERFLKPLASGAML-GAF 121 G +A+++A+ EIA + + +SV+N + C I G++EQK+ + + SG G+F Sbjct: 67 GTVAFSVAMTEIARACASTAVTVSVNNMI-CEVIQAVGSEEQKQACIPRICSGEFAAGSF 125 Query: 122 ALTEPQAGSDASGLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGK-RGIS 180 ALTE AGSD +G+ T A +GD ++LNG K FITS AGV +V+AVTD SA K +GIS Sbjct: 126 ALTETGAGSDPAGMTTTAVQDGDGWLLNGSKIFITSAPYAGVFVVWAVTDRSAPKGKGIS 185 Query: 181 AFIVPTDSPGYKVARVEDKLGQHASDTCQILFEDVKVPLANRLGEEGEGYRIALANLEGG 240 F+V PG + + E+K+GQHAS T +++F++ ++P +G+ +G+RIA+ L GG Sbjct: 186 CFLVEQGVPGLIIGKQEEKMGQHASATNELIFDNCRIPKNALMGKLNDGFRIAVGELAGG 245 Query: 241 RVGIASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYA 300 R+GI S +G+ AA + A YA ER FG+ I + QA+ + +AD T++ AR ++ A Sbjct: 246 RIGIGSLGLGLGLAAMDFATRYATERSQFGQKISDFQAIQWMIADAYTELEAARLLLMNA 305 Query: 301 AALRDSGKPALVEASMAKLFASEMAEKVCSSALQTLGGYGYLNDFPVERIYRDVRVCQIY 360 A +++GK EASMAK++A+E A K C A+Q LGGYGY DFPVER RD R+ IY Sbjct: 306 AFRKETGKSFAKEASMAKMYATEAANKACYKAVQMLGGYGYTKDFPVERYARDARITSIY 365 Query: 361 EGTSDIQRMVISRNL 375 EGT++IQR++ISR + Sbjct: 366 EGTNEIQRLIISREI 380 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 385 Length adjustment: 30 Effective length of query: 345 Effective length of database: 355 Effective search space: 122475 Effective search space used: 122475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory