Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_011940671.1 GURA_RS19730 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000016745.1:WP_011940671.1 Length = 297 Score = 137 bits (346), Expect = 3e-37 Identities = 81/203 (39%), Positives = 120/203 (59%), Gaps = 8/203 (3%) Query: 10 EKAYGDVK----VLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEIDGT 65 +K+ G+V LSNIN+ +++GE + VGPSGCGKSTLL ++AGL + G + IDG Sbjct: 31 KKSNGEVPSEFTALSNINMKVKKGEFVAIVGPSGCGKSTLLDILAGLTRPASGEIHIDGK 90 Query: 66 VVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQLGQ 125 + P RGI V Q YAL+P TVR N+ F L++ + E + + L Sbjct: 91 KITG-PALDRGI--VLQGYALFPWRTVRRNVEFGLEVKNVPKEERKDISQHFIRLVGLDG 147 Query: 126 YLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEAMPE 185 + +R P LSGG +QRVAI R++ DP+V L DEP + +DA R + E+ ++ + + Sbjct: 148 FENRYPLELSGGMKQRVAIARALAYDPEVLLMDEPFAAVDAQTRETLQDELLRIWDE-TK 206 Query: 186 STMVYVTHDQVEAMTLATRIVVL 208 T+++VTH EA+ LA R+ VL Sbjct: 207 KTIIFVTHSIDEAVYLADRVAVL 229 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 297 Length adjustment: 28 Effective length of query: 345 Effective length of database: 269 Effective search space: 92805 Effective search space used: 92805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory