Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_011939814.1 GURA_RS15130 LPS export ABC transporter ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_000016745.1:WP_011939814.1 Length = 246 Score = 108 bits (271), Expect = 7e-29 Identities = 63/218 (28%), Positives = 112/218 (51%), Gaps = 4/218 (1%) Query: 17 LKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITFEGQDITQMPTYELVRL 76 + VD+++ +GE++ L+G NGAGK+T + G R G + +G IT +P Y R Sbjct: 25 VNSVDLKVSSGEVIGLLGPNGAGKTTTFYMVVGLCRPDSGAVYLDGDAITDLPMYLRARK 84 Query: 77 GIAQSPEGRRIFPRMSVLENLQ--MGSITAKPGSFANELERVLTLFPRLKERISQRAGTM 134 GI+ P+ +F +++V ENL + ++ +E +L F R+ + + Sbjct: 85 GISYLPQEPSVFRKLTVEENLMAVLETMKLSRSRCRERVEELLAEF-RITHIARSKGFAL 143 Query: 135 SGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDINREQKMTVFMVEQNA 194 SGGE++ + I RAL + P +LLDEP G+ PL V I + D+ + + + V + + N Sbjct: 144 SGGERRRVEIARALATDPAFILLDEPFAGIDPLAVIDIQGIITDL-KNKGLGVLISDHNV 202 Query: 195 FHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 L + + Y++ G+V G ++ + + R YL Sbjct: 203 RETLGVCDKAYILNAGEVLEFGDPVQIAESRKAREIYL 240 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 246 Length adjustment: 23 Effective length of query: 213 Effective length of database: 223 Effective search space: 47499 Effective search space used: 47499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory