Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_011940671.1 GURA_RS19730 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000016745.1:WP_011940671.1 Length = 297 Score = 141 bits (356), Expect = 2e-38 Identities = 87/215 (40%), Positives = 128/215 (59%), Gaps = 10/215 (4%) Query: 10 RKSYGAVD----VIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGE 65 +KS G V + I++ +K+GEFV VGPSGCGKSTLL ++AGL G++ IDG+ Sbjct: 31 KKSNGEVPSEFTALSNINMKVKKGEFVAIVGPSGCGKSTLLDILAGLTRPASGEIHIDGK 90 Query: 66 RVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTP 125 ++ P RGI V Q YAL+P TV N+ FG+ + KEE + ++ L Sbjct: 91 KITG-PALDRGI--VLQGYALFPWRTVRRNVEFGLEVKNVPKEERKDISQHFIRLVGLDG 147 Query: 126 YLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSD 185 + +R P LSGG +QRVAI RA+ +P+V L DEP + +DA R + E+ ++ + + Sbjct: 148 FENRYPLELSGGMKQRVAIARALAYDPEVLLMDEPFAAVDAQTRETLQDELLRIWDE-TK 206 Query: 186 TTMIYVTHDQVEAMTLADRIVVLSA--GHIEQVGA 218 T+I+VTH EA+ LADR+ VL+ G I ++ A Sbjct: 207 KTIIFVTHSIDEAVYLADRVAVLTTNPGTIREIVA 241 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 297 Length adjustment: 28 Effective length of query: 334 Effective length of database: 269 Effective search space: 89846 Effective search space used: 89846 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory