Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate WP_011940133.1 GURA_RS16870 acyl-CoA dehydrogenase family protein
Query= BRENDA::Q96329 (436 letters) >NCBI__GCF_000016745.1:WP_011940133.1 Length = 384 Score = 186 bits (472), Expect = 1e-51 Identities = 128/380 (33%), Positives = 184/380 (48%), Gaps = 9/380 (2%) Query: 58 EEQAIRKKVRE----CMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIKG-YGCPG 112 E A +KK RE E+E+ P E FP I KLGA G+ GG+I G YG Sbjct: 4 ELSAAQKKARENACSFTEEEIIPFARENDANERFPLEIVRKLGARGLLGGTIPGAYGGAE 63 Query: 113 LSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACW 172 L ++ + EI R +S T + V SL I GSEAQ+ YLP L + + C+ Sbjct: 64 LDWISDGLIFEEIGRGCSSVRTTVSVQVSLVEQVIFNWGSEAQRRSYLPGLCRGEILGCF 123 Query: 173 ALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARN---TTTNQING 229 ALTEP GSDA+G+G TAT GW +NG K WI N AD+ I+FAR I+ Sbjct: 124 ALTEPGVGSDAAGIGATATPHGDGWLLNGTKNWITNGGVADIAIVFARTGPAAGNKGISA 183 Query: 230 FIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNS-FQDTSKVLAVSR 288 FIV +PG + +I K+GLR + ++ F+P + L + + L R Sbjct: 184 FIVDTKSPGFSSLEIRGKLGLRASSTAALTFRDCFLPGDALLGETGAGLKIALSALDNGR 243 Query: 289 VMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLC 348 VA +GI G D C Y + R+QFG +A+FQL Q + +M ++ A L+ +R Sbjct: 244 YGVAAGCVGIIQGCVDACVAYARRRQQFGRSIASFQLVQDMIARMAVDLAAARLLVFRAG 303 Query: 349 KLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYE 408 +L G + S+ K + S A A+ ++ G G V + D + YE Sbjct: 304 ELKNRGAANSLETSMAKYFASEAAVRAATDAIQVHGAYGYSNAHPVERYLRDAKVATIYE 363 Query: 409 GTYDINTLVTGREVTGIASF 428 GT I L+ G + G+ ++ Sbjct: 364 GTSQIQKLIIGEHLLGVKAY 383 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 384 Length adjustment: 31 Effective length of query: 405 Effective length of database: 353 Effective search space: 142965 Effective search space used: 142965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory