Align Ketoglutarate semialdehyde dehydrogenase (EC 1.2.1.26) (characterized)
to candidate WP_011938485.1 GURA_RS08035 aldehyde dehydrogenase family protein
Query= reanno::Smeli:SM_b20891 (477 letters) >NCBI__GCF_000016745.1:WP_011938485.1 Length = 475 Score = 286 bits (732), Expect = 1e-81 Identities = 167/475 (35%), Positives = 267/475 (56%), Gaps = 17/475 (3%) Query: 4 HQNLIAGEWVGGD--GVANINPSNTDDVVGEYARASAEDAKAAIAAAKAAFPAWSRSGIL 61 ++ LI GEW G D G+ INP + D ++G A+AED +AAI +A+ F S Sbjct: 5 YRMLIGGEWSGDDRTGIEVINPYD-DSLIGIVPEATAEDVEAAIVSARKGFDEISAMPAY 63 Query: 62 ERHAILKKTADEILARKDELGRLLSREEGKTLAEGIGETVRAGQIFEFFAGETLRLAGEV 121 +R IL++ ++ I+ K+E+ +++RE GK+ + E R+ + F+F A E GE+ Sbjct: 64 KRSEILERASEFIMRDKEEIAGIIAREAGKSWKYALAEAERSAETFKFAAIEARASHGEI 123 Query: 122 VPS----VRPGIGVEITREPAGVVGIITPWNFPIAIPAWKLAPALCYGNTIVFKPAELVP 177 VP V G R P G++G ITP+NFP+ + A KLAPA+ GN +V KPA P Sbjct: 124 VPMDASPVSAGRFGFYLRNPIGIIGAITPFNFPLNLVAHKLAPAIATGNAVVLKPATKTP 183 Query: 178 GCSWAIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDVQAITFTGSTATGKRVAVASV 237 S + ++L AGLP G LN+++G G+ VG +++ + ITFTGS G+ + S Sbjct: 184 LTSLKLAELLMEAGLPAGALNVIIGSGATVGNRLVEDERLAMITFTGSPPVGR--GIKSR 241 Query: 238 EHNRKYQLEMGGKNPFVVLDDADLSVAVEAAVNSAFFSTGQRCTASSRIIVTEGIHDRFV 297 ++ LE+G +P ++ +D D+ AV V +F ++GQ C + RI V + ++ F+ Sbjct: 242 SGLKRVTLELGSNSPTIIEEDGDVDKAVSRCVIGSFANSGQVCISVQRIFVHQSRYEEFI 301 Query: 298 AAMGERIKGLVVDDALKPGTHIGPVVDQSQLNQDTDYIAIGKQEGAKLAFGGEVISRDTP 357 A E + L V D IGP++ + +L + ++ K+ GA +A GG V+ Sbjct: 302 AKFVEATRSLKVGDPFDKTCDIGPMISRKELERAVSWLEEAKKLGAVIAVGGNVV----- 356 Query: 358 GFYLQPALFTEATNEMRISREEIFGPVAAVIRVKDYDEALAVANDTPFGLSSGIATTSLK 417 G L+P + T T +M++ E+F P+ +V+ K +DEAL +A+D+ +GL +GI T+ + Sbjct: 357 GNCLEPTVLTSVTRDMQVMCSEVFAPIVSVLPYKTFDEALEMADDSIYGLQAGIYTSDIN 416 Query: 418 HATHFKRNAEAGMVMVN-LPTAGVDFHVPFGGRKASSYGPREQGKYAAEFYTNVK 471 A + + G V++N +PT VD H+P+GG K S G RE +YA E TN+K Sbjct: 417 KAFKAVKRLDVGGVIINDVPTFRVD-HMPYGGNKESGLG-REGVRYAMEEMTNIK 469 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 475 Length adjustment: 33 Effective length of query: 444 Effective length of database: 442 Effective search space: 196248 Effective search space used: 196248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory