Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_011938770.1 GURA_RS09505 3-oxoacyl-[acyl-carrier-protein] reductase
Query= BRENDA::B8H1Z0 (248 letters) >NCBI__GCF_000016745.1:WP_011938770.1 Length = 246 Score = 106 bits (265), Expect = 4e-28 Identities = 75/243 (30%), Positives = 119/243 (48%), Gaps = 5/243 (2%) Query: 8 SLKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRC 67 SL G+ VITG GIG + A +GA+++ + E +R E+ + + Sbjct: 2 SLNGRVAVITGASRGIGKAVALKLAAEGADLVVTATSLEAARMTADEIIQLGGKALALKV 61 Query: 68 DLMNLEAIKAVF----AEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHMLFCT 123 D+ E ++++F E G VD+L+NNAG L + A WD ++VNL+ CT Sbjct: 62 DVSITEEVESLFHKTIEEFGRVDILINNAGITRDGLLLRMKEADWDAVLDVNLKGAFNCT 121 Query: 124 QAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRVTC 183 + A M K G ++N S+ +G V Y +KAG+ G+T+A AREL +I V Sbjct: 122 REAAKYMTKARYGRIVNISSVVGEIGNAGQVNYCASKAGMFGLTKATARELAKRNITVNA 181 Query: 184 VVPGNVKTKRQEKWYTPEGEAQIVAAQCLKGRIVPENVAALVLFLASDDASLCTGHEYWI 243 V PG ++T + + ++ L+ PE++AA V FL S + TGH + Sbjct: 182 VSPGFIETD-MTGVLSEKVRENLLQQIPLERLGQPEDIAAAVYFLVSAQSGYITGHVLSV 240 Query: 244 DAG 246 + G Sbjct: 241 NGG 243 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 246 Length adjustment: 24 Effective length of query: 224 Effective length of database: 222 Effective search space: 49728 Effective search space used: 49728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory